SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001027890.1.67411 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001027890.1.67411
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000994
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001027890.1.67411
Sequence length 135
Comment SMI1/KNR4 family protein [Leptospira interrogans]; AA=GCF_001969075.1; RF=na; TAX=44276; STAX=173; NAME=Leptospira interrogans serovar Pomona; strain=GR5; AL=Contig; RT=Major
Sequence
MNITNIFKNVWTIQPGTNLNAIQKIESIFKVTFPEDYKQILLWSNGGEGKVGNRYLSLWK
IEELVQLNEDYQIKKYIPEIVSIGTDGGEFCYAFDYRNNSNIPNFIEVPLGDLDSNSIVT
LGDKMTLVLQTWIHF
Download sequence
Identical sequences A0A098MTI1 A0A0E2CTQ1 A0A0E2D2G2 A0A161RQB4 A0A1R0JP68
WP_001027890.1.102083 WP_001027890.1.12132 WP_001027890.1.1506 WP_001027890.1.16487 WP_001027890.1.25259 WP_001027890.1.27867 WP_001027890.1.3175 WP_001027890.1.36087 WP_001027890.1.36581 WP_001027890.1.45262 WP_001027890.1.45679 WP_001027890.1.46993 WP_001027890.1.47686 WP_001027890.1.50856 WP_001027890.1.51443 WP_001027890.1.51531 WP_001027890.1.54587 WP_001027890.1.56629 WP_001027890.1.56812 WP_001027890.1.60409 WP_001027890.1.61403 WP_001027890.1.6171 WP_001027890.1.61777 WP_001027890.1.62172 WP_001027890.1.62202 WP_001027890.1.63688 WP_001027890.1.67243 WP_001027890.1.67411 WP_001027890.1.68799 WP_001027890.1.71080 WP_001027890.1.71461 WP_001027890.1.76063 WP_001027890.1.78739 WP_001027890.1.8167 WP_001027890.1.84376 WP_001027890.1.87965 WP_001027890.1.88138 WP_001027890.1.90188 WP_001027890.1.96462 WP_001027890.1.97385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]