SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001086401.1.101741 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001086401.1.101741
Domain Number 1 Region: 18-142
Classification Level Classification E-value
Superfamily PapD-like 3.4e-40
Family Pilus chaperone 0.0001
Further Details:      
 
Domain Number 2 Region: 145-221
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.7e-23
Family Periplasmic chaperone C-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001086401.1.101741
Sequence length 227
Comment fimbrial assembly chaperone [Salmonella enterica]; AA=GCF_001477965.1; RF=na; TAX=149385; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Hadar; strain=CVM N30645; AL=Contig; RT=Major
Sequence
MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDASISISNNDNVPYLIQSWAQS
ISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRESLYWLDIKSIPSSNPDN
KHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLTVKNPTPYYMNFATLSVG
SQKVKAPRYVAPFGNAQYTLPAAASGPIAWSIINDFGGTGPEHKQTP
Download sequence
Identical sequences A0A1Z3WX83 Q57T79
WP_001086401.1.101741 WP_001086401.1.11254 WP_001086401.1.11362 WP_001086401.1.11875 WP_001086401.1.12397 WP_001086401.1.14505 WP_001086401.1.14789 WP_001086401.1.15102 WP_001086401.1.15468 WP_001086401.1.16172 WP_001086401.1.1737 WP_001086401.1.17693 WP_001086401.1.17758 WP_001086401.1.20503 WP_001086401.1.21825 WP_001086401.1.22270 WP_001086401.1.22575 WP_001086401.1.23513 WP_001086401.1.23621 WP_001086401.1.26980 WP_001086401.1.27255 WP_001086401.1.27523 WP_001086401.1.28301 WP_001086401.1.3080 WP_001086401.1.31725 WP_001086401.1.32493 WP_001086401.1.35460 WP_001086401.1.35648 WP_001086401.1.37013 WP_001086401.1.38408 WP_001086401.1.39113 WP_001086401.1.39471 WP_001086401.1.40979 WP_001086401.1.42707 WP_001086401.1.4289 WP_001086401.1.43160 WP_001086401.1.43438 WP_001086401.1.43476 WP_001086401.1.43710 WP_001086401.1.44943 WP_001086401.1.46091 WP_001086401.1.46732 WP_001086401.1.47849 WP_001086401.1.50497 WP_001086401.1.50777 WP_001086401.1.51414 WP_001086401.1.51613 WP_001086401.1.54333 WP_001086401.1.54694 WP_001086401.1.5527 WP_001086401.1.56651 WP_001086401.1.57902 WP_001086401.1.58564 WP_001086401.1.59136 WP_001086401.1.60370 WP_001086401.1.60486 WP_001086401.1.61662 WP_001086401.1.63243 WP_001086401.1.63250 WP_001086401.1.64208 WP_001086401.1.64645 WP_001086401.1.65168 WP_001086401.1.65238 WP_001086401.1.66129 WP_001086401.1.66365 WP_001086401.1.66630 WP_001086401.1.6833 WP_001086401.1.69807 WP_001086401.1.71418 WP_001086401.1.71929 WP_001086401.1.72850 WP_001086401.1.74422 WP_001086401.1.75957 WP_001086401.1.76162 WP_001086401.1.76724 WP_001086401.1.77193 WP_001086401.1.78862 WP_001086401.1.7891 WP_001086401.1.79832 WP_001086401.1.80448 WP_001086401.1.82099 WP_001086401.1.82937 WP_001086401.1.84077 WP_001086401.1.86285 WP_001086401.1.87051 WP_001086401.1.87143 WP_001086401.1.87283 WP_001086401.1.88967 WP_001086401.1.90440 WP_001086401.1.9064 WP_001086401.1.93741 WP_001086401.1.95249 WP_001086401.1.99426 gi|62178746|ref|YP_215163.1| ABFG01000012|CDS_64658-65341 AE017220|CDS_204442-203759 321314.SC0176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]