SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001179585.1.100059 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001179585.1.100059
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.67e-17
Family SMI1/KNR4-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001179585.1.100059
Sequence length 170
Comment SMI1/KNR4 family protein [Bacillus thuringiensis]; AA=GCF_000161655.1; RF=na; TAX=527029; STAX=1428; NAME=Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1; strain=BGSC 4BA1; AL=Chromosome; RT=Major
Sequence
MQNIIIKKLEPVYEKDTKTVRTGTRVFGNIDKVNWMNVINPPLSKEEIQVFEDEMKTGFP
EPYKYLLSLMNGSFLANLVRIAGQPKIGGLSDEEEYFQPFDLYSFQQLYASKKIPDSYFV
FADSMDLGTIYAISEENRVLELHLRNKKVLRDLGTMDEWLDLLLEEAIRI
Download sequence
Identical sequences A0A0B5NUS0 C3GFE4
WP_001179585.1.100059 WP_001179585.1.23615 WP_001179585.1.42217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]