SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001190900.1.76902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001190900.1.76902
Domain Number 1 Region: 78-190
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.56e-25
Family Tetracyclin repressor-like, C-terminal domain 0.00000129
Further Details:      
 
Domain Number 2 Region: 7-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000211
Family Tetracyclin repressor-like, N-terminal domain 0.00024
Further Details:      
 
Domain Number 3 Region: 5-75
Classification Level Classification E-value
Superfamily PDB 0.000000177
Family PDB 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001190900.1.76902
Sequence length 192
Comment MULTISPECIES: TetR family transcriptional regulator [Bacillus]; AA=GCF_001619405.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=B4155; AL=Scaffold; RT=Major
Sequence
MQSKRGRPRNIETQKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVV
MDGFLSAAAARLPVPDTGSALNDILIHATSLANFLISREGTIINELVGEGQFDSKLAEEY
RVRYFQPRRLQAKQLLEKGIKRGELKENLDIELSIDLIYGPIFYRLLVTGEKLDDSYVHD
LVINAFEGIRLR
Download sequence
Identical sequences A0A0J7CLL3 A0A1B1L7X4 A0A1J9YZS8 A0A2K1RQD9 J8GSP3 Q81BJ4
gi|30021273|ref|NP_832904.1| 2fq4_A 2fq4A 226900.BC3163 APC24909 NP_832904.1.86172 WP_001190900.1.101843 WP_001190900.1.17374 WP_001190900.1.17899 WP_001190900.1.195 WP_001190900.1.21643 WP_001190900.1.23100 WP_001190900.1.26637 WP_001190900.1.35518 WP_001190900.1.3561 WP_001190900.1.41729 WP_001190900.1.5628 WP_001190900.1.57245 WP_001190900.1.58328 WP_001190900.1.58822 WP_001190900.1.67108 WP_001190900.1.76902 WP_001190900.1.79250 WP_001190900.1.79252 WP_001190900.1.80955 WP_001190900.1.82421 WP_001190900.1.87627 WP_001190900.1.98571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]