SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001467618.1.25843 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001467618.1.25843
Domain Number 1 Region: 60-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000968
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001467618.1.25843
Sequence length 163
Comment hypothetical protein [Escherichia coli]; AA=GCF_001648915.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=NIVEDI-P44; AL=Scaffold; RT=Major
Sequence
MTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQP
DYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDDS
ISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A024KR78 C8TY61 C8UHS5
gi|260870170|ref|YP_003236572.1| gi|387823510|ref|YP_003000997.2| 413997.ECB_03294 573235.ECO26_4532 585395.ECO103_4165 585396.ECO111_4253 gi|387823510|ref|YP_003000997.2| gi|260857551|ref|YP_003231442.1| gi|260846229|ref|YP_003224007.1| gi|254163369|ref|YP_003046477.1| WP_001467618.1.25843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]