SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001540416.1.44943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001540416.1.44943
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily PapD-like 5.76e-38
Family Pilus chaperone 0.00044
Further Details:      
 
Domain Number 2 Region: 159-248
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.0000000000000118
Family Periplasmic chaperone C-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001540416.1.44943
Sequence length 250
Comment fimbrial assembly chaperone protein StcB [Salmonella enterica]; AA=GCF_000187565.1; RF=na; TAX=904139; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Choleraesuis str. SCSA50; strain=A50; AL=Chromosome; RT=Major
Sequence
MLLTNLFNRRRSSPVFYKQGRVNMKILSAVLLSAIILPAHAGIVIYGTRVIYPAEKKEVV
VQLVNQGEQASLVQSWIDDGNTSLPPEKIQVPFMLTPPVARVAAESGQQLKIKKMPNSLP
DNKESLFYLNVLDIPPNSQENAGKNVLKFTMQNRIKLIWRPSRIAAVTKDSFQRIGLFRS
NKTVIMKNDTANWITVTDVKAGNTKINDQTIMLPPLSTQNINMKYASTSQYEVTIIDDNG
NYISSKINVK
Download sequence
Identical sequences Q57MI9
AE017220|CDS_2269627-2268875 WP_001540416.1.22270 WP_001540416.1.32493 WP_001540416.1.36948 WP_001540416.1.44943 WP_001540416.1.50777 WP_001540416.1.57902 WP_001540416.1.60486 WP_001540416.1.76162 321314.SC2166 gi|62180736|ref|YP_217153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]