SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002028779.1.101309 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002028779.1.101309
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-28
Family SMI1/KNR4-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002028779.1.101309
Sequence length 156
Comment MULTISPECIES: SMI1/KNR4 family protein [Bacillus]; AA=GCF_001566365.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MB.1; AL=Contig; RT=Major
Sequence
MKTTIWTEDDYLKLAPINDELIKKAEEVLNVKLPESYINLLKEQNGGTLRLDAHPTSEPN
SWADDHVNVSGLYGISFDENESSILESHYFIQEWEMPENLVLLSGDGHTWIALDYRNVAE
NPPVIFIDNEVEQIIELAPNFESFLQNLTTYEYDEE
Download sequence
Identical sequences A0A0F5RPG5 A0A1Y5ZIL3 A0A229MCS2 A0A243NKL1 B7HUT7 C2SAV0 F0PPP3
WP_002028779.1.100241 WP_002028779.1.100684 WP_002028779.1.10069 WP_002028779.1.101309 WP_002028779.1.11060 WP_002028779.1.13299 WP_002028779.1.18840 WP_002028779.1.24377 WP_002028779.1.26499 WP_002028779.1.27334 WP_002028779.1.31685 WP_002028779.1.32522 WP_002028779.1.33061 WP_002028779.1.35255 WP_002028779.1.43762 WP_002028779.1.46746 WP_002028779.1.46864 WP_002028779.1.47097 WP_002028779.1.48311 WP_002028779.1.48599 WP_002028779.1.51087 WP_002028779.1.52756 WP_002028779.1.55057 WP_002028779.1.59773 WP_002028779.1.6753 WP_002028779.1.69970 WP_002028779.1.72514 WP_002028779.1.79658 WP_002028779.1.80964 WP_002028779.1.82986 WP_002028779.1.8450 WP_002028779.1.8923 WP_002028779.1.91404 WP_002028779.1.91569 gi|375286936|ref|YP_005107375.1| gi|384182792|ref|YP_005568554.1| gi|217962411|ref|YP_002340983.1| 405534.BCAH187_A5088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]