SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002263007.1.59541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002263007.1.59541
Domain Number 1 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-43
Family Ribonuclease PH domain 1-like 0.00000932
Further Details:      
 
Domain Number 2 Region: 10-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-43
Family Ribonuclease PH domain 1-like 0.0000363
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-28
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 4 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-28
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 614-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.45e-21
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 6 Region: 559-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.28e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000141
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002263007.1.59541
Sequence length 730
Comment polyribonucleotide nucleotidyltransferase [Streptococcus mutans]; AA=GCF_000229165.1; RF=na; TAX=1074137; STAX=1309; NAME=Streptococcus mutans TCI-169; strain=TCI-169; AL=Contig; RT=Major
Sequence
MSKQVFETIFAGKKLAVEIGQVAKQANGAALVRYGDSTVLSAAVMSKKMSTGDFFPLQIN
YEEKRYAAGKFPGGFNKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDA
DASAPMAAMFGSSLALSISDIPFNGPIAGVQVAYLDGQYVINPTAEEKKASLLELTVAGT
KEAINMVESGAKELSEDIMLEALLKGHEAVRELIAFQEEIIAAVGKEKAEVELLQVDADL
QAEIVGKYNADLQKAVQIEEKKAREIATEAVKEHVTAEYEERYAEHEEHDRIMRDVAEIL
EQMEHAEVRRLITEDKVRPDGRRVDEIRPLDAEIDFLPKVHGSGLFTRGQTQALSVLTLA
PMGDTQIVDGLDEEYKKRFMHHYNFPQYSVGETGRYGAPGRREIGHGALGERALAQVLPS
LEAFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIEGITPQILEEALAQAKKARFEILDVI
EKVIPAPRLELAPTAPKIDTIKVDVDKIKIVIGKGGETIDKIIEETGVKIDIDEDGNIAI
YSSDQEAINRTKEIIASLVREAKVGEIYEAEVVRIEKFGAFVHLFDKTDALVHISEIAWT
RTNKVEDVLAVGDKVTVKVVKVDDKGRIDASMKALLPRPPRSEKSNKEDHQSVRHHGSPK
DDKGKEKYDK
Download sequence
Identical sequences Q8DWB2
210007.SMU.155 NP_720625.1.8892 WP_002263007.1.15378 WP_002263007.1.15966 WP_002263007.1.17367 WP_002263007.1.3499 WP_002263007.1.38244 WP_002263007.1.50032 WP_002263007.1.50881 WP_002263007.1.51119 WP_002263007.1.51808 WP_002263007.1.59541 WP_002263007.1.65860 WP_002263007.1.70601 WP_002263007.1.71645 WP_002263007.1.72550 WP_002263007.1.7464 WP_002263007.1.77215 WP_002263007.1.78804 WP_002263007.1.8393 WP_002263007.1.9086 WP_002263007.1.94193 gi|24378670|ref|NP_720625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]