SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002486917.1.74736 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002486917.1.74736
Domain Number - Region: 110-213
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000122
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002486917.1.74736
Sequence length 218
Comment hypothetical protein [Staphylococcus epidermidis]; AA=GCF_000418125.2; RF=na; TAX=1344989; STAX=1282; NAME=Staphylococcus epidermidis CIM28; strain=CIM28; AL=Scaffold; RT=Major
Sequence
MDYLQYLKRFNKNIKILNENELEKISQRWKYIMLSENKLERVVEYWKEVLGGNLSNTIRY
IENHLIDIQFIKVNEDYYILYNILTENKEEGIYVGKIPNENKKISSIYDKLPNSLQTFYS
NLHDGFYYFASDSMGILELSMVKNLNEYDWAILEEIDEPKINLDTSYIIFDSGMGGFIVV
DVNKGIDDATIWFDDEAPMYQKNFWNFCDEWIKMGMEE
Download sequence
Identical sequences A0A0E2MXV9
WP_002486917.1.15840 WP_002486917.1.2088 WP_002486917.1.24406 WP_002486917.1.33011 WP_002486917.1.44114 WP_002486917.1.48318 WP_002486917.1.49813 WP_002486917.1.62700 WP_002486917.1.63535 WP_002486917.1.63865 WP_002486917.1.666 WP_002486917.1.74736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]