SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002515617.1.91146 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002515617.1.91146
Domain Number 1 Region: 346-466
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.42e-26
Family HD domain 0.0087
Further Details:      
 
Domain Number 2 Region: 228-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000495
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002515617.1.91146
Sequence length 542
Comment MULTISPECIES: ribonuclease Y [Propionibacteriaceae]; AA=GCF_001660885.1; RF=na; TAX=1747; STAX=1747; NAME=Cutibacterium acnes; strain=49.1.L1; AL=Contig; RT=Major
Sequence
MLIALIAVSVLAVAAIIGSLADRRAIGRRAERAESERDVKALELSRSQERLSRASQDLAD
SRKDVAKARAELESSRTRASDEARRADNADQARRSAEALLEINRRSVEELTERDHRLQEA
RRHLEEGLDKIEQDRLELAERSSQLDERDAELDRRHGQIVTELERVAGMSLDEARDELVE
HLGREARVFAENSARAIVTEATASAEAKARHIVAEVIQRCSSEMVADTVVSVVPLPSNEM
KGRVIGREGRNIRTFEQVTGVTVIIDDTPEIVLLSCFDPMRREVARQALTDLVEDGRIHP
ISIERAHQRAVDRIEDMCLDAAADALSRAGIDDIDDRLLPILGSLRFRTSYGQQVLDHCV
ECARLAANLAAEIGADIEICRRAAFLHDLGKSLTPGVEGSSHAAIGAELARRYGESEEVI
HAIAAHHDEIDPVSVTDFIVKAADAISAARPGARRESLEAHVRRMDTIEEIATSFPGVVR
AFALQAGREMQILVDPGAVDDHQASRLARQIALAIGEQVTVPGRTRVTVIRSFQAIETVG
DA
Download sequence
Identical sequences A0A1J4XI46 A0A2B7JVQ1 D4HDH3 Q6A900
267747.PPA1014 gi|407935409|ref|YP_006851051.1| WP_002515617.1.101196 WP_002515617.1.102131 WP_002515617.1.15006 WP_002515617.1.1505 WP_002515617.1.18145 WP_002515617.1.18363 WP_002515617.1.20232 WP_002515617.1.23000 WP_002515617.1.2563 WP_002515617.1.26091 WP_002515617.1.27635 WP_002515617.1.28533 WP_002515617.1.2928 WP_002515617.1.29850 WP_002515617.1.30003 WP_002515617.1.31624 WP_002515617.1.3171 WP_002515617.1.31800 WP_002515617.1.32488 WP_002515617.1.33260 WP_002515617.1.34331 WP_002515617.1.36413 WP_002515617.1.38538 WP_002515617.1.40065 WP_002515617.1.41101 WP_002515617.1.41273 WP_002515617.1.41331 WP_002515617.1.42227 WP_002515617.1.43449 WP_002515617.1.43983 WP_002515617.1.48475 WP_002515617.1.49294 WP_002515617.1.49524 WP_002515617.1.50375 WP_002515617.1.50378 WP_002515617.1.50533 WP_002515617.1.56110 WP_002515617.1.56441 WP_002515617.1.56454 WP_002515617.1.56826 WP_002515617.1.57145 WP_002515617.1.57563 WP_002515617.1.58125 WP_002515617.1.59962 WP_002515617.1.60466 WP_002515617.1.60649 WP_002515617.1.61734 WP_002515617.1.62864 WP_002515617.1.66193 WP_002515617.1.66916 WP_002515617.1.67213 WP_002515617.1.70496 WP_002515617.1.7197 WP_002515617.1.73086 WP_002515617.1.73414 WP_002515617.1.74417 WP_002515617.1.74746 WP_002515617.1.74916 WP_002515617.1.7599 WP_002515617.1.76554 WP_002515617.1.76841 WP_002515617.1.7771 WP_002515617.1.80166 WP_002515617.1.80187 WP_002515617.1.821 WP_002515617.1.82350 WP_002515617.1.83430 WP_002515617.1.90730 WP_002515617.1.91146 WP_002515617.1.91610 WP_002515617.1.91798 WP_002515617.1.92292 WP_002515617.1.97417 WP_002515617.1.97839 WP_002515617.1.99435 gi|387503386|ref|YP_005944615.1| gi|482890319|ref|YP_007887482.1| gi|50842497|ref|YP_055724.1| gi|295130574|ref|YP_003581237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]