SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002612137.1.13107 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002612137.1.13107
Domain Number 1 Region: 221-401
Classification Level Classification E-value
Superfamily Subtilisin-like 3.8e-23
Family Subtilases 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002612137.1.13107
Sequence length 416
Comment hypothetical protein [Stigmatella aurantiaca]; AA=GCF_000165485.1; RF=representative genome; TAX=378806; STAX=41; NAME=Stigmatella aurantiaca DW4/3-1; strain=DW4/3-1; AL=Complete Genome; RT=Major
Sequence
MTLKSVGNPLRPQVRTESSQGQTTRSPANAPAAPSNQALKSSFDTATAQQGPRLAQAAGG
TGPVRSFLDRAGEARSAATRTQAAGGNAIKDFLSRLNPGDDTIAIFDSFGPGTTHGDNVE
HVVDENSEYSDDDIRTVPVGSSPAPAGASLDERIEQRASSFLDSTSDAMQGILDNPGDIT
VINQSQSISPVRIADEMWQEVRNDPEAKAELAQELGLEEGASDTEILQALVDRVDGVFEN
SPEIAASKERYDRLSGELEDAGILHVVTAGNTGDFLDTLDEMGVEYDGDFADSVLFNEHT
IVVAASTGGKRDQIADFSTPSDFVTVAIDGTDIEVVGGETANGTSFAAPQVTALIAEMRR
INPDLTNDEIRDLLAKAATDTSATAQEEGHGILDPDKALMLARLSLLKDLPVLRAV
Download sequence
Identical sequences Q098Y5
WP_002612137.1.13107 WP_002612137.1.14028 gi|310824937|ref|YP_003957295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]