SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002633653.1.53523 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002633653.1.53523
Domain Number 1 Region: 12-59
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000654
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002633653.1.53523
Sequence length 654
Comment hypothetical protein [Myxococcus hansupus]; AA=GCF_000280925.3; RF=na; TAX=1297742; STAX=1297742; NAME=Myxococcus hansupus; strain=mixupus; AL=Complete Genome; RT=Major
Sequence
MHEWLEALRKSVKASSSGVSPEEIRRAETECGVPFPEELSDLYQAFNGGELNGEVLLFPL
HGAEGDPSVLEKTRLKLEGLPAAGLWRIGLKGQHRHLFGARKSAMVEQGDGGGPLPGWVE
ALEGDDWVYGTWEGEKRQMRLYRSLKDMLDVLVPPAEVESFGERTFARAMNAVLQGALSG
VQVDGESEEEALEGEAQAEEDETLEAAELAEEVVEEEGGEIRELAYEYDDESSASRDEDG
MRARSGRAGKARSGKAEQMPLAIGGAGVLFPRGAPRKGAKVEAEPAPAKTRSAKKSAPVE
AAAGKDAAPTPLFAEEAAPAQPSVAKKSSKKATAAQVAAPDAISEVPVAAPAPTAVAEKP
VTKKKPSAKKASVTAVESEASAAPEAPAGQSTAKKSAAAKKPSAAVVLHGEAASEEPVVA
KASATENPAAKKAASEKAVAKKSSAPQAASKQTAAAKAQATKASSSAAKVASPKTASKQT
AVAKGQATKAASSATKVAPLKAASKQTAVAKAPAKKAPSSAAKVASPKAASKQTAAAKIP
SKKASAVKRAPASKPASKKTAAKAAPSKTPVAKKVPVSKAASKKPAAKKAPVSKAASKKP
ASKKVHASKAASKTPVAKAASSKNPAAKKAPSKALATKKSASQKPVSKKGARGR
Download sequence
Identical sequences A0A0H4X639
WP_002633653.1.53523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]