SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002732648.1.15998 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002732648.1.15998
Domain Number 1 Region: 217-382
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-42
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 15-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-28
Family KaiB-like 0.00044
Further Details:      
 
Domain Number 3 Region: 141-223
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000785
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002732648.1.15998
Sequence length 384
Comment adaptive-response sensory-kinase sasA [Microcystis aeruginosa]; AA=GCF_001725075.1; RF=na; TAX=267869; STAX=1126; NAME=Microcystis aeruginosa NIES-98; strain=NIES-98; AL=Scaffold; RT=Major
Sequence
MLPSNEPLTALGRETTTPLSIQLLLFVDDRPSSQEIIRQIQSYLQSLQSDYPIDLQIIEI
RQQPHLVEHFRLVATPALVKIAPGPRHTLAGSNLVEQFKKWLVRWQKAIKEEIKNDHAED
GQLQEVEHSGELIRIADEVFRLKQEKEELLEQLKFKDQILAMLAHDLRSPLTAASIAVET
LELAYHQPDTERSLQLREQLHQQARKQFRIMNRLITDILQASKSMAAQFTLHQSKFYLQA
LCQEILSQFTDTFQEKTLIFQSDIPQDLPPVYADEELIRQVIINLLENGIKYTPAGGAIT
LSVLHRTTQKVQVSISDTGPGIPEEKQEHIFEGHVRLKRDEGKEGYGIGLSVCRKIIRAH
YGQIWVDSVPDHGSSFHFTLPVYR
Download sequence
Identical sequences A0A1E4Q7G9 L7EAV1 S3J9H0
WP_002732648.1.15998 WP_002732648.1.42333 WP_002732648.1.86711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]