SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002759883.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002759883.1.4043
Domain Number 1 Region: 358-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.09e-59
Family Pyruvate oxidase and decarboxylase PP module 0.0000723
Further Details:      
 
Domain Number 2 Region: 3-175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.98e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000231
Further Details:      
 
Domain Number 3 Region: 182-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.1e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002759883.1.4043
Sequence length 550
Comment acetolactate synthase large subunit [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MGELNTAELLVKCLENEGVEYIFGLPGEENLDVLEALKNSSIKFITTRHEQGAAFMADVY
GRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAM
FAPVTKWNKQIVRPGITPEVVRRAFKTAQSEKPGAVHIDLPENIAAMAADGHPLPLDSQE
KVYASYRTLNMAAAVISKAKNPLILAGNGAIRANASEALTEFATALNIPVANTFMGKGVI
PYTHPLALWAVGLQQRDLISCAFERSDLIIAVGYDLIEYSPKKWNPDGKLPIIHIGMTPA
EIDSSYAPVVEVVGDITDSLIDILKRADRQNKPTPVTAGLKTEIRADYETYANDTGFPIK
PQKLIYDLRQVMGPEDIAICDVGAHKMWMARQYHSDCPNTCIISNGFAAMGIAIPGAIAA
KLVYPNKRIVAVTGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQLNYFGTSS
FIKFGNPDFVKFAESMGLKGYRVESTQDLIPTLEEAFRQEVPTVIDVPVDYGENLRLSQK
SGDLSCQIWE
Download sequence
Identical sequences B0JPB2 I4FNZ8 I4HGB6
gi|166363342|ref|YP_001655615.1| WP_002759883.1.24258 WP_002759883.1.4043 WP_002759883.1.50331 449447.MAE_06010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]