SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002760058.1.7764 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002760058.1.7764
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily L28p-like 1.88e-24
Family Ribosomal protein L31p 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002760058.1.7764
Sequence length 77
Comment 50S ribosomal protein L31 [Microcystis aeruginosa]; AA=GCF_000312725.1; RF=na; TAX=1160282; STAX=1126; NAME=Microcystis aeruginosa PCC 9806; strain=PCC 9806; AL=Scaffold; RT=Major
Sequence
MPKKIHPTWYPEAKVICNGELVMTVGSTKPEIHVEVWSGNHPFYTGTQKMIDTEGRVDRF
LRKYKMGDKSSKKADQK
Download sequence
Identical sequences A0A0A1VS83 A0A0F6RME8 A0A0K1RY63 A0A1V4BMB9 B0JY33 I4FPC4 I4GYA9 I4HK59
gi|166367990|ref|YP_001660263.1| 449447.MAE_52490 WP_002760058.1.10452 WP_002760058.1.24258 WP_002760058.1.39664 WP_002760058.1.4043 WP_002760058.1.43975 WP_002760058.1.50331 WP_002760058.1.50673 WP_002760058.1.7764 WP_002760058.1.79847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]