SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002763152.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002763152.1.4043
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-29
Family HD domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002763152.1.4043
Sequence length 198
Comment phosphohydrolase [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQAGLLHDLAKFFKPKKL
LKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILEAIRNHTLGKPNMSDLS
CIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLKYLLSSHCPIHPRTVLTR
NWALQIVKEQPTETKTID
Download sequence
Identical sequences A0A0K1RXJ7 B0JP68 I4FVI9
WP_002763152.1.24258 WP_002763152.1.4043 449447.MAE_05570 gi|166363298|ref|YP_001655571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]