SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002796134.1.50331 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002796134.1.50331
Domain Number 1 Region: 12-327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-55
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 401-508
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.01e-29
Family Pentapeptide repeats 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002796134.1.50331
Sequence length 528
Comment serine/threonine protein kinase [Microcystis aeruginosa]; AA=GCF_000312265.1; RF=na; TAX=1160285; STAX=1126; NAME=Microcystis aeruginosa PCC 9809; strain=PCC 9809; AL=Scaffold; RT=Major
Sequence
MTYCLNPNCTQPKNAPTALICESCGSKLLLHDRYQTLRILGKGGFGATFVSSDLSLPDKP
LCVVKQLQPPPKDASVFRMAKDLFDREAETLAKLGVHPQIPRLLDYFEDNQEFYLVQEYV
KGHNLHQEVKKRGPFSEAGVKQFLSELLPILKYVHEQRVIHRDIKPANLIRRQTDRKLVL
IDFGAVKNPVNSVMANADSQTALTNFAVGTQGFAPPEQMAMRPVYASDIYAVGATCLYLL
TGKSPKAIEVDINTGELLWEKLVKVSPQFAKVLKTMLEVSVRHRYKSAQEVMDALDMTAY
ADSLAQSLIAAPMVTSQPPRQNSGSMATSSVSVPLKSKFRPKNQNPEASPDNMLGGQMAF
SLFNTNVLNKSKARSSTELTLLKKKPRLDEKALLDAYNNGRRNFAQEELPNLNLAKAKLV
GVNFCQSKLTRANLQGADLSNADLGRANLSQAILKSTNLNNAYLGYADLEKADLRGANLT
GAHLRYANLKDANLCGANLSDAQVTREQIALAKTNWLTVMPNGKRGSW
Download sequence
Identical sequences B0JYD9 I4HKT1
449447.MAE_53550 gi|166368096|ref|YP_001660369.1| WP_002796134.1.4043 WP_002796134.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]