SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002810296.1.20919 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002810296.1.20919
Domain Number 1 Region: 42-191
Classification Level Classification E-value
Superfamily TPR-like 0.000000125
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002810296.1.20919
Sequence length 212
Comment hypothetical protein [Nitrosococcus oceani]; AA=GCF_000740745.1; RF=na; TAX=314279; STAX=1229; NAME=Nitrosococcus oceani C-27; strain=C-27; AL=Scaffold; RT=Major
Sequence
MALDIYASDQEKSEAIRQWWRENGRAVLVGLIIGLLALLGLRSWTNYEQSRTSEASSLYQ
QILAAKDQDANAEIYNSAEHLLQEYSDTPYGLFSVLILAKEDQARGDLETATERLKGALE
YARHPSLQKVIYLRLARLLLAMGSPQEVLTMLAEVKPGSFSSAYAELRGDAYVALGQPSE
AQLAYQEALLGLGPSEQYRQILQMKLDNLAQP
Download sequence
Identical sequences A0A0E2Z4A7 Q3JCW3
WP_002810296.1.20919 WP_002810296.1.60716 WP_002810296.1.77844 WP_002810296.1.91979 gi|77164338|ref|YP_342863.1| 323261.Noc_0820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]