SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002810527.1.20919 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002810527.1.20919
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.23e-67
Family Glutathione peroxidase-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002810527.1.20919
Sequence length 199
Comment peroxidase [Nitrosococcus oceani]; AA=GCF_000740745.1; RF=na; TAX=314279; STAX=1229; NAME=Nitrosococcus oceani C-27; strain=C-27; AL=Scaffold; RT=Major
Sequence
MSVLVTQVAPDFSAPAVMADGTIKENFRLSDARGQYVVLFFYPLDFTFVCPSEILAHNNR
LEDFKERGVEVIGVSVDSQYSHYAWRNTPVVDGGIGAIGFPLVADLSHDITRAYGVEHPD
GVALRASFLIDKNGVVQHQVVNNLPLGRDVEEMLRVVDALQFTEEHGEVCPAGWRKGEEA
IRPDAEGVAEYLSKHASAL
Download sequence
Identical sequences A0A0E2ZP89 Q3JCQ5
WP_002810527.1.20919 WP_002810527.1.60716 WP_002810527.1.77844 WP_002810527.1.91979 gi|77164396|ref|YP_342921.1| 323261.Noc_0878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]