SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002810835.1.60716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002810835.1.60716
Domain Number 1 Region: 40-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000837
Family Coronavirus S2 glycoprotein 0.01
Further Details:      
 
Weak hits

Sequence:  WP_002810835.1.60716
Domain Number - Region: 58-205
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0133
Family Formin homology 2 domain (FH2 domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002810835.1.60716
Sequence length 216
Comment DNA repair ATPase [Nitrosococcus oceani]; AA=GCF_000740735.1; RF=na; TAX=1229; STAX=1229; NAME=Nitrosococcus oceani; strain=AFC132; AL=Contig; RT=Major
Sequence
MLNITLRAFLTSLFLLLLTGCQAAYYKTMEEFGYHKRDILADRVEEVRDTQIEAKEQFQS
ALEQFSSVVNYDGGDLEDLYEELNGEYQASQKKAEAVHDRIASVENVAGALFQEWEEELD
QYDNPSLRRSSQQQLTQTRTRYDKLIRAMKRAEAKIEPVLTTFHDQVLFLKHNLNARAIA
SLQGELSTIETDVNRLVQEMEAAIDEANEFIKTLES
Download sequence
Identical sequences A0A0E2Z251 Q3JB95
WP_002810835.1.20919 WP_002810835.1.60716 WP_002810835.1.77844 WP_002810835.1.91979 gi|77164906|ref|YP_343431.1| 323261.Noc_1412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]