SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002811294.1.77844 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002811294.1.77844
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.46e-37
Family Glutathione peroxidase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002811294.1.77844
Sequence length 172
Comment hypothetical protein [Nitrosococcus oceani]; AA=GCF_000155655.1; RF=na; TAX=473788; STAX=1229; NAME=Nitrosococcus oceani AFC27; strain=AFC27; AL=Scaffold; RT=Major
Sequence
MNKPRLVLFYLLLVAIPAVPTAMAAEIGQQAPNCLLKPFEKEDQVFLQQWQGKVVYVDFW
ASWCPPCLKSFPFLNDLHQRFSDQGLHIVGINVDEKLSDAQDFLARVPAHFDVVVDPDQQ
CARSFDIQAMPSSFLIDQKGVIRHTHLGFRSGDTQELEAWTQKLLQEKTANP
Download sequence
Identical sequences A0A0E2Z885 Q3JBS2
WP_002811294.1.20919 WP_002811294.1.77844 WP_002811294.1.91979 gi|77164729|ref|YP_343254.1| 323261.Noc_1223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]