SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002813132.1.77844 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002813132.1.77844
Domain Number - Region: 91-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00644
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002813132.1.77844
Sequence length 134
Comment integrating conjugative element protein [Nitrosococcus oceani]; AA=GCF_000155655.1; RF=na; TAX=473788; STAX=1229; NAME=Nitrosococcus oceani AFC27; strain=AFC27; AL=Scaffold; RT=Major
Sequence
MVLTSTLSAPAIAGEAAPAIEVFTDSTFQVVSASDNTTVYVMDRINQLLQVLSEDLPSDP
ENAKQLVLARFQRMDAQLSSELENAAKGLVQAMQYGINRYPAIVINGNAVVYGVTDVSAA
TQLYQRWQTRGARQ
Download sequence
Identical sequences A0A0E2Z9N8 Q3JDC7
WP_002813132.1.20919 WP_002813132.1.77844 WP_002813132.1.91979 323261.Noc_0650 2005420387 gi|77164174|ref|YP_342699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]