SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002813475.1.91979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002813475.1.91979
Domain Number 1 Region: 50-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-30
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002813475.1.91979
Sequence length 196
Comment photosynthetic protein synthase I [Nitrosococcus oceani]; AA=GCF_000012805.1; RF=representative genome; TAX=323261; STAX=1229; NAME=Nitrosococcus oceani ATCC 19707; strain=ATCC 19707; AL=Complete Genome; RT=Major
Sequence
MRNRALCNLAAIMMLLLLAPTKLIASTIVLKHVAPLQKETIAHLNQGSKSDSGQWRLVVF
GFTNCSDVCPMSLANLSMLMGAAEEENIKLAGTFVTIDPDRDTHAVLAEYTDKFNADIAY
LRLTGKDLEHLKSTFGVETVFYTKNAGNRIHYQVDHSSTGFLIDPEGRIRVLFDAVEDAV
DIANMIHEQGTLFSHE
Download sequence
Identical sequences A0A0E2YZ63 Q3J750
323261.Noc_2900 gi|77166351|ref|YP_344876.1| WP_002813475.1.20919 WP_002813475.1.60716 WP_002813475.1.77844 WP_002813475.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]