SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002850035.1.42882 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002850035.1.42882
Domain Number 1 Region: 321-516
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-42
Family Ribonuclease PH domain 1-like 0.0000488
Further Details:      
 
Domain Number 2 Region: 5-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-39
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 479-572
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.16e-24
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 141-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.93e-22
Family Ribonuclease PH domain 2-like 0.0034
Further Details:      
 
Domain Number 5 Region: 584-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 660-726
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000395
Family Cold shock DNA-binding domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002850035.1.42882
Sequence length 728
Comment polyribonucleotide nucleotidyltransferase [Campylobacter fetus]; AA=GCF_001699565.1; RF=na; TAX=1273272; STAX=196; NAME=Campylobacter fetus subsp. venerealis cfvi92/203; strain=cfvi92/203; AL=Contig; RT=Major
Sequence
MQCSIEVNNQIEIFDLNKVAKQAAGAVLMRVKNTVVLAAVAREDAQVEEDFLPLTVQYIE
KQYAAGRIPGGYVKRETKPGDFETLTSRIIDRSLRPLFPKGYAYPTQIVVMVLSSDPEVD
LQVVSLNAASVALYLSDIPVNSPVCGVRVGHINGKFVINPSNSELKNSALDLYVAGVKDE
LLMIEMRSLPNEQNEIVPVIAIDPMMDPSLNEGFVSRQKMNEFSEDLMIDAIKLATEAIL
KGSNAYEEAFRNYKKETANLEYKPEIENENVAIYINEFYKEDVKAAINQMAKSERASELS
KIAKQIALSEVAQKEGWDEALISNILGKYKKKLVRTGIIKDKKRADGRGLKDVRPISIET
NILPNAHGSCLFTRGQTQALVVTTLGTDNDAQMSEYLTEKNAVADKFMFNYNFPGFSVGE
ASPLKAPGRRELGHGNLAKRALYPSIDLNSPYSLRVVSEILESNGSSSMASVCGGSLSLR
AAGVETIKLVAGVAMGLVFEGDEHAVLTDIMGLEDHDGDMDFKVAGSKDGITALQMDIKL
GGISLDVLKEALYQAKEARDHILNLMVKADEEIVVNEDVLPKLELFSVDPSKIVDIIGQA
GKTIKEIIEKFEVSIDLDRDKGEVKIAGGERQKVEAAKDYIIQITQKEQRSGGFRNKREY
KNVTPFNIGDEFEGEIKKMAAFGAFISLRDGVDGLLHISKIVSPLKEGDTIKVKVSDIKG
GKISLDLN
Download sequence
Identical sequences A0RQD0 W0DBS4
gi|118474584|ref|YP_892413.1| 360106.CFF8240_1257 WP_002850035.1.1289 WP_002850035.1.1469 WP_002850035.1.16919 WP_002850035.1.17016 WP_002850035.1.36062 WP_002850035.1.38168 WP_002850035.1.39057 WP_002850035.1.41035 WP_002850035.1.42882 WP_002850035.1.44411 WP_002850035.1.46075 WP_002850035.1.46714 WP_002850035.1.48558 WP_002850035.1.51765 WP_002850035.1.5603 WP_002850035.1.59303 WP_002850035.1.60351 WP_002850035.1.63275 WP_002850035.1.68475 WP_002850035.1.71429 WP_002850035.1.74407 WP_002850035.1.77129 WP_002850035.1.77394 WP_002850035.1.81562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]