SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002853829.1.617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002853829.1.617
Domain Number 1 Region: 307-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.06e-28
Family HD domain 0.037
Further Details:      
 
Domain Number 2 Region: 207-301
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002853829.1.617
Sequence length 517
Comment ribonuclease Y [Campylobacter jejuni]; AA=GCF_001419195.1; RF=na; TAX=1440060; STAX=197; NAME=Campylobacter jejuni CVM 41936; strain=CVM 41936; AL=Contig; RT=Major
Sequence
MIESLIALIAAIVGLGIGYLVAKKINDAKYEIFVEQAKAKAKAIEYEAELILKDAKNSIL
NAELEVKKKYEEKTHKIQKDFNQKFDDLSKKEQKLQQEEEKLKEDKEYLCKSQKHIQDLQ
SDVDKLKNKYQEKLDDVLKILEHSTGLTQNEAKEIILKKVEENSREQIAHIVRKYEEEAK
NEAKRKANFIIAQATSRFAGEFAAERLINVINIKNDELKGRIIGKEGRNVKTLEMVLGVD
IIIDDTPGAIIVSCFNLYRRAIATKVIELLVEDGRIQPARIEEIHEKVCKEFDSAILEEG
ETIVMDLGLNKIHPEIVKLIGKLKYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARR
AGILHDIGKALTHDFEGSHVDLGAELCKRYKEHPVVINAIYAHHGHEEATSIESAAVCAA
DTLSAARPGARREVLEAFLKRVSELEDIAKSKEGIKNAYAINAGREIRVIANAQLVNDDE
SVLLAKEIAAEIQEKMQYPGEIKVNVIRELRAVEYAK
Download sequence
Identical sequences A0A0E1EZB1 A0A0W8LLK2 A0A1E7P3B4 A8FMR4
gi|384441831|ref|YP_005658134.1| 407148.C8J_1152 gi|549693189|ref|YP_008624147.1| gi|315124674|ref|YP_004066678.1| WP_002853829.1.100027 WP_002853829.1.100358 WP_002853829.1.10096 WP_002853829.1.101299 WP_002853829.1.101351 WP_002853829.1.101503 WP_002853829.1.1018 WP_002853829.1.10588 WP_002853829.1.10733 WP_002853829.1.11336 WP_002853829.1.11684 WP_002853829.1.1234 WP_002853829.1.12514 WP_002853829.1.1272 WP_002853829.1.13308 WP_002853829.1.13372 WP_002853829.1.13698 WP_002853829.1.13832 WP_002853829.1.1433 WP_002853829.1.154 WP_002853829.1.15577 WP_002853829.1.16428 WP_002853829.1.17476 WP_002853829.1.17574 WP_002853829.1.1773 WP_002853829.1.18219 WP_002853829.1.18427 WP_002853829.1.18713 WP_002853829.1.1908 WP_002853829.1.19299 WP_002853829.1.19381 WP_002853829.1.20368 WP_002853829.1.20424 WP_002853829.1.208 WP_002853829.1.21928 WP_002853829.1.22150 WP_002853829.1.2270 WP_002853829.1.22767 WP_002853829.1.23128 WP_002853829.1.23184 WP_002853829.1.23465 WP_002853829.1.24558 WP_002853829.1.24675 WP_002853829.1.24785 WP_002853829.1.24786 WP_002853829.1.26244 WP_002853829.1.26385 WP_002853829.1.26622 WP_002853829.1.27672 WP_002853829.1.28120 WP_002853829.1.28212 WP_002853829.1.28815 WP_002853829.1.29291 WP_002853829.1.29330 WP_002853829.1.29414 WP_002853829.1.29637 WP_002853829.1.29911 WP_002853829.1.30041 WP_002853829.1.30067 WP_002853829.1.30396 WP_002853829.1.3060 WP_002853829.1.30944 WP_002853829.1.32103 WP_002853829.1.32115 WP_002853829.1.32154 WP_002853829.1.32316 WP_002853829.1.3307 WP_002853829.1.33225 WP_002853829.1.33281 WP_002853829.1.33800 WP_002853829.1.34555 WP_002853829.1.34607 WP_002853829.1.3467 WP_002853829.1.35424 WP_002853829.1.36238 WP_002853829.1.37001 WP_002853829.1.37441 WP_002853829.1.38495 WP_002853829.1.38579 WP_002853829.1.39523 WP_002853829.1.39743 WP_002853829.1.3984 WP_002853829.1.39894 WP_002853829.1.39951 WP_002853829.1.40511 WP_002853829.1.40824 WP_002853829.1.41766 WP_002853829.1.41786 WP_002853829.1.42130 WP_002853829.1.43856 WP_002853829.1.44006 WP_002853829.1.44197 WP_002853829.1.44556 WP_002853829.1.44675 WP_002853829.1.44860 WP_002853829.1.44863 WP_002853829.1.45391 WP_002853829.1.45712 WP_002853829.1.45744 WP_002853829.1.45819 WP_002853829.1.46068 WP_002853829.1.46471 WP_002853829.1.4658 WP_002853829.1.4756 WP_002853829.1.47718 WP_002853829.1.48021 WP_002853829.1.48191 WP_002853829.1.48196 WP_002853829.1.48314 WP_002853829.1.4932 WP_002853829.1.50385 WP_002853829.1.50766 WP_002853829.1.51193 WP_002853829.1.51298 WP_002853829.1.52362 WP_002853829.1.5243 WP_002853829.1.52430 WP_002853829.1.52620 WP_002853829.1.52727 WP_002853829.1.5371 WP_002853829.1.53751 WP_002853829.1.53913 WP_002853829.1.5402 WP_002853829.1.54071 WP_002853829.1.54432 WP_002853829.1.54780 WP_002853829.1.55453 WP_002853829.1.55555 WP_002853829.1.56351 WP_002853829.1.56766 WP_002853829.1.57393 WP_002853829.1.5784 WP_002853829.1.58047 WP_002853829.1.5843 WP_002853829.1.58472 WP_002853829.1.59195 WP_002853829.1.5922 WP_002853829.1.59550 WP_002853829.1.60607 WP_002853829.1.61249 WP_002853829.1.61383 WP_002853829.1.617 WP_002853829.1.61951 WP_002853829.1.62327 WP_002853829.1.62451 WP_002853829.1.6284 WP_002853829.1.62886 WP_002853829.1.62922 WP_002853829.1.63528 WP_002853829.1.6402 WP_002853829.1.64482 WP_002853829.1.65548 WP_002853829.1.65735 WP_002853829.1.66467 WP_002853829.1.67138 WP_002853829.1.67431 WP_002853829.1.68262 WP_002853829.1.68599 WP_002853829.1.69225 WP_002853829.1.69275 WP_002853829.1.71156 WP_002853829.1.71470 WP_002853829.1.71710 WP_002853829.1.71813 WP_002853829.1.72197 WP_002853829.1.72780 WP_002853829.1.73406 WP_002853829.1.73916 WP_002853829.1.74254 WP_002853829.1.74339 WP_002853829.1.74864 WP_002853829.1.75705 WP_002853829.1.76444 WP_002853829.1.76847 WP_002853829.1.77538 WP_002853829.1.77828 WP_002853829.1.78165 WP_002853829.1.78209 WP_002853829.1.78370 WP_002853829.1.78406 WP_002853829.1.78684 WP_002853829.1.79201 WP_002853829.1.79296 WP_002853829.1.79613 WP_002853829.1.79682 WP_002853829.1.7977 WP_002853829.1.80006 WP_002853829.1.80017 WP_002853829.1.80289 WP_002853829.1.80694 WP_002853829.1.80796 WP_002853829.1.80802 WP_002853829.1.81128 WP_002853829.1.81520 WP_002853829.1.81664 WP_002853829.1.81793 WP_002853829.1.8205 WP_002853829.1.82138 WP_002853829.1.82383 WP_002853829.1.84307 WP_002853829.1.84677 WP_002853829.1.84795 WP_002853829.1.85042 WP_002853829.1.8525 WP_002853829.1.85473 WP_002853829.1.85911 WP_002853829.1.86318 WP_002853829.1.86557 WP_002853829.1.86570 WP_002853829.1.8669 WP_002853829.1.87281 WP_002853829.1.87478 WP_002853829.1.87495 WP_002853829.1.87514 WP_002853829.1.88713 WP_002853829.1.88784 WP_002853829.1.88833 WP_002853829.1.88917 WP_002853829.1.89236 WP_002853829.1.89384 WP_002853829.1.90766 WP_002853829.1.91378 WP_002853829.1.91753 WP_002853829.1.9196 WP_002853829.1.92170 WP_002853829.1.9226 WP_002853829.1.92637 WP_002853829.1.92680 WP_002853829.1.92725 WP_002853829.1.93617 WP_002853829.1.9405 WP_002853829.1.94563 WP_002853829.1.94702 WP_002853829.1.94840 WP_002853829.1.95060 WP_002853829.1.95411 WP_002853829.1.9546 WP_002853829.1.95496 WP_002853829.1.95796 WP_002853829.1.9591 WP_002853829.1.96302 WP_002853829.1.96328 WP_002853829.1.96501 WP_002853829.1.96510 WP_002853829.1.96616 WP_002853829.1.9689 WP_002853829.1.97347 WP_002853829.1.97689 WP_002853829.1.98261 WP_002853829.1.98846 WP_002853829.1.98870 WP_002853829.1.99444 WP_002853829.1.99811 WP_002853829.1.99960 gi|157415472|ref|YP_001482728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]