SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002951888.1.20409 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002951888.1.20409
Domain Number 1 Region: 29-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 9.71e-86
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 342-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-27
Family Glycosyl hydrolases family 32 C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002951888.1.20409
Sequence length 480
Comment sucrose-6-phosphate hydrolase [Streptococcus thermophilus]; AA=GCF_000011845.1; RF=na; TAX=299768; STAX=1308; NAME=Streptococcus thermophilus CNRZ1066; strain=CNRZ1066; AL=Complete Genome; RT=Major
Sequence
MNLPTEVRYRPYTDWTDGEKTKIKENVGKSPWRASYHIEPETGLLNDPNGFSYFNGKFQL
FYQSWPFGAAHGLKQWVHTESEDLVHFTETGVKLLPDHENDSHGAYSGSAYQIGDKLFIF
YTGNVRDENWIRDPRQIGAWMDKNYKIKKIDKVLIKKPTDVTEHFRDPQIFDYKGQFYAI
IGAQNHNKQGFIKFYKAVDNDVENWVEVGDLDFGGTGSEYMIECPNIVFVDGKPVLLYCP
QGLDKAELDYNNIYPNTYKIFQDFDPEKAALVGGTPIINLDYGFEAYATQGFNTPDGRAL
IVSWIGLPDVDYPTDKYDYQGAMSLVKELSIKDGKLYQYPVEAITSLRTRQEDFSEKTAT
TNTYELELNFQANTQTELVLFADQEGNGLSLTVDTAKGKVILDRSKAGEQYATDFGTSRE
CTLDAGQAATANIFVDNSIVEIFFNKGEKVFTSRVFPSAEQTGIKVASGNVSGHYFDLKY
Download sequence
Identical sequences A0A0E2RCH5 A0A0P6V7S8 Q5M2R8
gi|386087336|ref|YP_006003210.1| gi|55823627|ref|YP_142068.1| WP_002951888.1.14318 WP_002951888.1.20409 WP_002951888.1.22909 WP_002951888.1.25847 WP_002951888.1.35143 WP_002951888.1.49400 WP_002951888.1.53867 WP_002951888.1.70431 WP_002951888.1.71797 WP_002951888.1.75065 WP_002951888.1.77415 WP_002951888.1.83814 WP_002951888.1.84427 WP_002951888.1.90490 WP_002951888.1.92232 WP_002951888.1.92807 WP_002951888.1.94133 264199.stu1735 299768.str1735 gi|55821707|ref|YP_140149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]