SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002965231.1.58868 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002965231.1.58868
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-53
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 293-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-50
Family Ribonuclease PH domain 1-like 0.0000113
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.29e-30
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 452-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.15e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 622-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.22e-21
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002965231.1.58868
Sequence length 714
Comment MULTISPECIES: polyribonucleotide nucleotidyltransferase [Brucella]; AA=GCF_000480275.1; RF=na; TAX=1341685; STAX=36855; NAME=Brucella canis 96-7258; strain=96-7258; AL=Contig; RT=Major
Sequence
MFNTHKVEIEWGGRPLTLETGKIARQADGAVLATYGETAVLATVVSAKEPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFVDGYKNDTQVVITVLQH
DLENNPDILSMVAASAALTISGVPFMGPISGARVGYIDGEYVLNPNIDEMPESKLDLVVA
GTSEAVLMVESEAQELPEDVMLGAVMFGHKSFQPVIDAIIKLAEVAAKEPRDFQPEDLSE
LEAKVLAVVENDLREAYKITEKQARYAAVDAAKAKAKEHFFPEGVEETEMSAEQFATIFK
HLQAKIVRWNILDTGNRIDGRDLSTVRPIVSEVGILPRTHGSALFTRGETQAIVVATLGT
GEDEQMIDALTGTYKESFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPAA
EQFPYTIRAVSEITESNGSSSMATVCGTSLALMDAGVPIVRPVAGIAMGLIKEGERFAVL
SDILGDEDHLGDMDFKVAGTEFGITSLQMDIKIDGITEEIMKVALEQAKGGRVHILGEMA
KAISSSRAELGEFAPRIEVMNIPTDKIRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIA
SSNGKEIEAAKKWIHSIVAEPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADR
VAKTTDVVKEGQKVWVKLMGFDERGKVRLSMKVVDQETGKEIVAEKKKEEVDAE
Download sequence
Identical sequences A0A0E1WZI2 A0A0M1WCF1 A0A1M4LE02 A0A1P8S393 A0A2K4NMW4 A9M9Z8 B0CK15 B2S9G0 C4ITZ6 C7LF41 D0RKY1 D1CUS4 D6LMA1 D7H0R6 E2PQV1 Q2YQR3 Q57A96
gi|376275245|ref|YP_005115684.1| WP_002965231.1.100018 WP_002965231.1.100204 WP_002965231.1.100443 WP_002965231.1.101247 WP_002965231.1.101965 WP_002965231.1.102082 WP_002965231.1.10307 WP_002965231.1.10630 WP_002965231.1.10893 WP_002965231.1.11306 WP_002965231.1.1158 WP_002965231.1.11620 WP_002965231.1.11769 WP_002965231.1.12241 WP_002965231.1.13460 WP_002965231.1.13576 WP_002965231.1.13826 WP_002965231.1.14542 WP_002965231.1.14633 WP_002965231.1.16733 WP_002965231.1.16975 WP_002965231.1.17378 WP_002965231.1.17733 WP_002965231.1.1800 WP_002965231.1.18034 WP_002965231.1.18635 WP_002965231.1.19508 WP_002965231.1.19641 WP_002965231.1.19645 WP_002965231.1.20012 WP_002965231.1.20317 WP_002965231.1.21149 WP_002965231.1.2214 WP_002965231.1.22340 WP_002965231.1.22583 WP_002965231.1.23458 WP_002965231.1.24196 WP_002965231.1.24428 WP_002965231.1.24496 WP_002965231.1.24655 WP_002965231.1.2483 WP_002965231.1.25101 WP_002965231.1.25382 WP_002965231.1.25561 WP_002965231.1.25729 WP_002965231.1.26599 WP_002965231.1.27052 WP_002965231.1.2778 WP_002965231.1.2839 WP_002965231.1.2874 WP_002965231.1.2877 WP_002965231.1.29336 WP_002965231.1.31094 WP_002965231.1.31106 WP_002965231.1.31239 WP_002965231.1.31463 WP_002965231.1.32337 WP_002965231.1.32731 WP_002965231.1.33220 WP_002965231.1.33599 WP_002965231.1.33753 WP_002965231.1.3390 WP_002965231.1.35970 WP_002965231.1.3681 WP_002965231.1.37797 WP_002965231.1.38790 WP_002965231.1.38925 WP_002965231.1.39021 WP_002965231.1.39039 WP_002965231.1.39963 WP_002965231.1.40138 WP_002965231.1.40407 WP_002965231.1.40624 WP_002965231.1.40649 WP_002965231.1.408 WP_002965231.1.40871 WP_002965231.1.41044 WP_002965231.1.41835 WP_002965231.1.41941 WP_002965231.1.42427 WP_002965231.1.43359 WP_002965231.1.43583 WP_002965231.1.43597 WP_002965231.1.4428 WP_002965231.1.44294 WP_002965231.1.44793 WP_002965231.1.44949 WP_002965231.1.44989 WP_002965231.1.45546 WP_002965231.1.45559 WP_002965231.1.46182 WP_002965231.1.46432 WP_002965231.1.47558 WP_002965231.1.47610 WP_002965231.1.4847 WP_002965231.1.49427 WP_002965231.1.49542 WP_002965231.1.49953 WP_002965231.1.50051 WP_002965231.1.50053 WP_002965231.1.50282 WP_002965231.1.5052 WP_002965231.1.52027 WP_002965231.1.5236 WP_002965231.1.53128 WP_002965231.1.53481 WP_002965231.1.5394 WP_002965231.1.54440 WP_002965231.1.54776 WP_002965231.1.54779 WP_002965231.1.55684 WP_002965231.1.56334 WP_002965231.1.56683 WP_002965231.1.56952 WP_002965231.1.57564 WP_002965231.1.57925 WP_002965231.1.58525 WP_002965231.1.58539 WP_002965231.1.58868 WP_002965231.1.59086 WP_002965231.1.59515 WP_002965231.1.59985 WP_002965231.1.61536 WP_002965231.1.61811 WP_002965231.1.61997 WP_002965231.1.62872 WP_002965231.1.63730 WP_002965231.1.63732 WP_002965231.1.64013 WP_002965231.1.64124 WP_002965231.1.64849 WP_002965231.1.64853 WP_002965231.1.64883 WP_002965231.1.64905 WP_002965231.1.65131 WP_002965231.1.65454 WP_002965231.1.6555 WP_002965231.1.65651 WP_002965231.1.66260 WP_002965231.1.66340 WP_002965231.1.66810 WP_002965231.1.67402 WP_002965231.1.67893 WP_002965231.1.67996 WP_002965231.1.67997 WP_002965231.1.68488 WP_002965231.1.69451 WP_002965231.1.69829 WP_002965231.1.70296 WP_002965231.1.70322 WP_002965231.1.71002 WP_002965231.1.71077 WP_002965231.1.71194 WP_002965231.1.71846 WP_002965231.1.72012 WP_002965231.1.72533 WP_002965231.1.72916 WP_002965231.1.74005 WP_002965231.1.75434 WP_002965231.1.75458 WP_002965231.1.75766 WP_002965231.1.76350 WP_002965231.1.76433 WP_002965231.1.77165 WP_002965231.1.77321 WP_002965231.1.77683 WP_002965231.1.77899 WP_002965231.1.78109 WP_002965231.1.78716 WP_002965231.1.78821 WP_002965231.1.7984 WP_002965231.1.79963 WP_002965231.1.8012 WP_002965231.1.80266 WP_002965231.1.80697 WP_002965231.1.81027 WP_002965231.1.81558 WP_002965231.1.81617 WP_002965231.1.82113 WP_002965231.1.8223 WP_002965231.1.8224 WP_002965231.1.82448 WP_002965231.1.8278 WP_002965231.1.8307 WP_002965231.1.83161 WP_002965231.1.84512 WP_002965231.1.85322 WP_002965231.1.85721 WP_002965231.1.8657 WP_002965231.1.86923 WP_002965231.1.87603 WP_002965231.1.87867 WP_002965231.1.87893 WP_002965231.1.88404 WP_002965231.1.8878 WP_002965231.1.90420 WP_002965231.1.90689 WP_002965231.1.91338 WP_002965231.1.91710 WP_002965231.1.92518 WP_002965231.1.9303 WP_002965231.1.93230 WP_002965231.1.93367 WP_002965231.1.93454 WP_002965231.1.93795 WP_002965231.1.94126 WP_002965231.1.94770 WP_002965231.1.94775 WP_002965231.1.97511 WP_002965231.1.97741 WP_002965231.1.98076 WP_002965231.1.98362 WP_002965231.1.98455 WP_002965231.1.98704 WP_002965231.1.99221 WP_002965231.1.99373 WP_002965231.1.99421 gi|376272110|ref|YP_005150688.1| 262698.BruAb1_2142 359391.BAB1_2169 430066.BAbS19_I20300 470137.BSUIS_A2006 483179.BCAN_A2211 568815.BMI_I2190 gi|163844182|ref|YP_001628587.1| gi|82700915|ref|YP_415489.1| gi|189025218|ref|YP_001935986.1| gi|62291006|ref|YP_222799.1| gi|161620077|ref|YP_001593964.1| gi|256370564|ref|YP_003108075.1| gi|340791750|ref|YP_004757215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]