SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003020501.1.59625 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003020501.1.59625
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000281
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-44
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-29
Family Ribonuclease PH domain 2-like 0.0000977
Further Details:      
 
Domain Number 4 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.82e-27
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.59e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0017
Further Details:      
 
Domain Number 7 Region: 622-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000021
Family Cold shock DNA-binding domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003020501.1.59625
Sequence length 693
Comment polyribonucleotide nucleotidyltransferase [Francisella tularensis]; AA=GCF_000742015.1; RF=na; TAX=263; STAX=263; NAME=Francisella tularensis; strain=FTV; AL=Scaffold; RT=Major
Sequence
MKIFREVFELGNKEIILETGGMARQADGSVTVSCGNNVVLVTTVVKKSVADGTDFFPLSV
HYLEKTYAAGKIPGGFLRREGRPSEEQILISRLIDRSIRPSFPDGFFNEIQIVATVLSYD
GAFSPDILALIGASASLAISGAPYDDVVAGVRVGYTNGKYILNPNKQDLRDSDLDLVVSG
TDDAILMVESEANSLPESVMLGGILYAHKHLKTIINSINRLAKVASKPRIEYSIYQINKF
LKSQIKSQFFGEIKNAYTIASKQERNLKLNAIRKNVLEYIFSSDVDGNEYTEKEILEAFH
DIEKDLVRSNILEGKPRIDGRCTETIRPINVKIGVLPGVHGSALFTRGETQALVVTTLGS
DRDAQLVESLDGIEKCRYMLHYNFPPYSVGECGMVGMAPKRREIGHANLAKRATQAVFPN
EEAYPYVVRVVSEILESNGSSSMATVCGSSLSMMDAGVPIAEPVAGIAMGLIKDGAKYAV
LSDILGDEDHLGDMDFKVAGTRYGVTALQMDIKIKGISREILEQALEQARAGRLHILGIM
NEVIKEHKEAVSDVAPQIHVMNINPAKIKDVVGRGGATVKGIVEKTGAQIDTSDSGEVKV
FAKDKKSMDMAVAMIEEIVAEVEEGQVYKGKIVKLLDSGVFVNLLGSQDGYLPFSEIEQA
GMKTNSLVEGQGLEVLVQNIDRGGRVKLSLVAR
Download sequence
Identical sequences A0A0E2ZH63 A0A0H3TPX1 Q14IC9 Q5NGX7
WP_003020501.1.101979 WP_003020501.1.10388 WP_003020501.1.11695 WP_003020501.1.1833 WP_003020501.1.19035 WP_003020501.1.2301 WP_003020501.1.25812 WP_003020501.1.31410 WP_003020501.1.35965 WP_003020501.1.36081 WP_003020501.1.3831 WP_003020501.1.38368 WP_003020501.1.38474 WP_003020501.1.38662 WP_003020501.1.40634 WP_003020501.1.44744 WP_003020501.1.52816 WP_003020501.1.56738 WP_003020501.1.5829 WP_003020501.1.59625 WP_003020501.1.60146 WP_003020501.1.61154 WP_003020501.1.65967 WP_003020501.1.66077 WP_003020501.1.66092 WP_003020501.1.67317 WP_003020501.1.75261 WP_003020501.1.77053 WP_003020501.1.80616 WP_003020501.1.82545 WP_003020501.1.87851 WP_003020501.1.98147 YP_169715.1.84429 gi|385794460|ref|YP_005830866.1| gi|379725671|ref|YP_005317857.1| gi|110670290|ref|YP_666847.1| gi|379717067|ref|YP_005305403.1| 177416.FTT_0699 393115.FTF0699 gi|56707819|ref|YP_169715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]