SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003032777.1.92567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003032777.1.92567
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-24
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003032777.1.92567
Sequence length 117
Comment hypothetical protein [Francisella tularensis]; AA=GCF_000156415.1; RF=na; TAX=563990; STAX=263; NAME=Francisella tularensis subsp. novicida FTG; strain=FTG; AL=Scaffold; RT=Major
Sequence
MTATLETKATNLGLDNIQKHIFLCCDQERQKCCAGDVSLKAWEYLKKRLQELGLSQNGHI
YRTKTYCLRICQNGPIAVVHPDNVWYHSCTPEVLEEIIQKHLIGGEIVKKYVFNKNS
Download sequence
Identical sequences A0A1J0L1L1 A0Q463
WP_003032777.1.11577 WP_003032777.1.21561 WP_003032777.1.36632 WP_003032777.1.43725 WP_003032777.1.59804 WP_003032777.1.64199 WP_003032777.1.66025 WP_003032777.1.70888 WP_003032777.1.72761 WP_003032777.1.89268 WP_003032777.1.89309 WP_003032777.1.91892 WP_003032777.1.92567 gi|385792041|ref|YP_005825017.1| gi|118496732|ref|YP_897782.1| 401614.FTN_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]