SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003034461.1.70888 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003034461.1.70888
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000123
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003034461.1.70888
Sequence length 205
Comment MULTISPECIES: hypothetical protein [Francisella]; AA=GCF_000834965.1; RF=na; TAX=264; STAX=263; NAME=Francisella tularensis subsp. novicida; strain=DPG 3A-IS; AL=Complete Genome; RT=Major
Sequence
MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDF
AVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQA
NEIKMLMQRDIISTYKTIVSEREVNAESNPDAQNINVLTLIITFVFYYFIKLKISIPTKD
KNIIKEIKELLSEPNFIKTIKAKGA
Download sequence
Identical sequences A0A1I9YAX8 A0A1S2WVL9 A0Q7F6 O52734
401614.FTN_1290 WP_003034461.1.11577 WP_003034461.1.21561 WP_003034461.1.26434 WP_003034461.1.36632 WP_003034461.1.43725 WP_003034461.1.59804 WP_003034461.1.64199 WP_003034461.1.66025 WP_003034461.1.69967 WP_003034461.1.70888 WP_003034461.1.72761 WP_003034461.1.76402 WP_003034461.1.82488 WP_003034461.1.89268 WP_003034461.1.89309 WP_003034461.1.91892 WP_003034461.1.92567 gi|385793265|ref|YP_005826241.1| gi|118497875|ref|YP_898925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]