SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003038655.1.11577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003038655.1.11577
Domain Number 1 Region: 47-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.34e-20
Family Thioltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003038655.1.11577
Sequence length 255
Comment hypothetical protein [Francisella tularensis]; AA=GCF_000014645.1; RF=na; TAX=401614; STAX=263; NAME=Francisella tularensis subsp. novicida U112; strain=U112; AL=Complete Genome; RT=Major
Sequence
MKKLLVTLGISSVLILSSCANHQNIQAQEASVNHKTSNDYAKIIAIPDIVKDLLSDPATP
TVGPQDANKAVVVFFDYGCGKCAEISKEINKLMKENPNVKFIFKAYPSLKRDAKVANYAS
LVANEAYLQGGSELFLAYNKAIFAQRETNGELTVQDVDNVVKRLGIKVNDTKLKQKAAAE
ELDTRKLGKLIGFQGPHSFVILPTNLASMNANDLGNNVDKVYVISDKQTNVITDNYQQAA
KWVATNIQAQLNNIK
Download sequence
Identical sequences A0Q5H7
401614.FTN_0597 WP_003038655.1.11577 WP_003038655.1.21561 WP_003038655.1.72761 gi|118497196|ref|YP_898246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]