SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003149757.1.98111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003149757.1.98111
Domain Number 1 Region: 35-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.94e-29
Family DsbC/DsbG C-terminal domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003149757.1.98111
Sequence length 254
Comment MULTISPECIES: DSBA oxidoreductase [Proteobacteria]; AA=GCF_900146425.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; AL=Contig; RT=Major
Sequence
MEQKRPSIPMQVQAFRRRRWQFRWPWALAAVLVALLLIWLVSRSPGGSTPQTSAPVSDTQ
VAGPPWQMGNPEGRFTLTLYADLECPFCRSYFPVLKRWVAGNADVTLQWHHLPLAAHEPA
ASAEARLAECAGEAGSHAAFWQAVEWVYAHTRSDGQGLPEGLRYPDLTPAIEQCLASERP
DAPIRAQTAEATNSGVIATPSLRLHDRETGKAILLQGPIEGDALLSAMDMLAAGDPAAIP
TSEMPADVVGDMPR
Download sequence
Identical sequences A0A086BQS6 A0A1G7UKS2 A0A1V2Y5K8 A0A2E5T8U6 Q1LKU5 Q8GQ64
266264.Rmet_2354 gi|94311290|ref|YP_584500.1| WP_003149757.1.100899 WP_003149757.1.11130 WP_003149757.1.11178 WP_003149757.1.12400 WP_003149757.1.12480 WP_003149757.1.12497 WP_003149757.1.13079 WP_003149757.1.13092 WP_003149757.1.14690 WP_003149757.1.15789 WP_003149757.1.22782 WP_003149757.1.23231 WP_003149757.1.24442 WP_003149757.1.25444 WP_003149757.1.25839 WP_003149757.1.28878 WP_003149757.1.29003 WP_003149757.1.30810 WP_003149757.1.31271 WP_003149757.1.34731 WP_003149757.1.35599 WP_003149757.1.37542 WP_003149757.1.38510 WP_003149757.1.40482 WP_003149757.1.42634 WP_003149757.1.43022 WP_003149757.1.43317 WP_003149757.1.445 WP_003149757.1.45298 WP_003149757.1.47314 WP_003149757.1.48990 WP_003149757.1.52578 WP_003149757.1.54239 WP_003149757.1.57841 WP_003149757.1.57966 WP_003149757.1.58417 WP_003149757.1.5850 WP_003149757.1.60396 WP_003149757.1.61294 WP_003149757.1.63423 WP_003149757.1.63697 WP_003149757.1.63989 WP_003149757.1.64825 WP_003149757.1.65247 WP_003149757.1.66286 WP_003149757.1.67948 WP_003149757.1.7038 WP_003149757.1.71570 WP_003149757.1.71738 WP_003149757.1.72772 WP_003149757.1.7448 WP_003149757.1.783 WP_003149757.1.78542 WP_003149757.1.79921 WP_003149757.1.81368 WP_003149757.1.8203 WP_003149757.1.82703 WP_003149757.1.83617 WP_003149757.1.85815 WP_003149757.1.86925 WP_003149757.1.87716 WP_003149757.1.89494 WP_003149757.1.89848 WP_003149757.1.89939 WP_003149757.1.9034 WP_003149757.1.91527 WP_003149757.1.94230 WP_003149757.1.96852 WP_003149757.1.96967 WP_003149757.1.9698 WP_003149757.1.98111 WP_003149757.1.98814 WP_003149757.1.98819 WP_003149757.1.99341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]