SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003181881.1.62618 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003181881.1.62618
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-50
Family Ribonuclease PH domain 1-like 0.0000171
Further Details:      
 
Domain Number 2 Region: 292-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.69e-49
Family Ribonuclease PH domain 1-like 0.0000116
Further Details:      
 
Domain Number 3 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.06e-31
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 4 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-29
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.4e-21
Family Cold shock DNA-binding domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003181881.1.62618
Sequence length 705
Comment MULTISPECIES: polyribonucleotide nucleotidyltransferase [Bacillus]; AA=GCF_000315975.1; RF=na; TAX=1232672; STAX=1402; NAME=Bacillus licheniformis CGMCC 3963; strain=CGMCC 3963; AL=Contig; RT=Major
Sequence
MGQEKHVFSIDWAGRKLTVETGQLAKQANGAVMVRYGDTAVLSTATASKEPKTVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVVSIVMSV
DQDCSSEMAAMFGSSLALCVSDIPFEGPIAGVTVGRVDNKFIINPTLEQLEKSDIHLVVA
GTKDAINMVEAGADEVPEEIMLEAIMFGHEEIKRLIAFQEEIVAAVGKEKSEITLYEIDS
DLKEKVRGMAESNLLKAIQVHEKHAREDAISEVKNEVLAKFEEEEHDEETLKQVKDILSQ
LVKNEVRRLITEEKVRPDGRAVDEIRPLSSEVGLLPRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPQFSVGETGPMRGPGRREIGHGALGERALEPIVPSEK
DFPYTIRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKSGDNYTVLT
DIQGMEDHLGDMDFKVAGTSKGVTALQMDIKIEGLSREILEEALQQAKKGRMEILESMLS
TLAESRKELSPYAPKILTMSINPDKIRDVIGPSGKQINKIIEDTGVKIDIEQDGTIFISS
TDESMNQKAKKIIEDLVREVEVGQLYLGKVKRIEKFGAFVELFSGKDGLVHISELALERV
GKVEDVVKIGDELLVKVTEIDKQGRVNLSRKAVLREQKEKEEQKS
Download sequence
Identical sequences A0A1Y0YF51 Q65JH5 T5HV38
gi|404489164|ref|YP_006713270.1| gi|52080276|ref|YP_079067.1| WP_003181881.1.10695 WP_003181881.1.1290 WP_003181881.1.20727 WP_003181881.1.21456 WP_003181881.1.22930 WP_003181881.1.27377 WP_003181881.1.27603 WP_003181881.1.27836 WP_003181881.1.30581 WP_003181881.1.31090 WP_003181881.1.31877 WP_003181881.1.34504 WP_003181881.1.34863 WP_003181881.1.35726 WP_003181881.1.35764 WP_003181881.1.42641 WP_003181881.1.46361 WP_003181881.1.46635 WP_003181881.1.47006 WP_003181881.1.48016 WP_003181881.1.50447 WP_003181881.1.54544 WP_003181881.1.55910 WP_003181881.1.57471 WP_003181881.1.62441 WP_003181881.1.62618 WP_003181881.1.64701 WP_003181881.1.70162 WP_003181881.1.719 WP_003181881.1.71919 WP_003181881.1.74244 WP_003181881.1.8120 WP_003181881.1.85389 WP_003181881.1.8660 WP_003181881.1.86740 WP_003181881.1.86759 WP_003181881.1.9500 WP_003181881.1.95031 WP_003181881.1.9558 WP_003181881.1.96953 WP_003181881.1.98374 WP_003181881.1.99505 279010.BL01217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]