SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003291809.1.36575 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003291809.1.36575
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.63e-45
Family SMI1/KNR4-like 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003291809.1.36575
Sequence length 135
Comment cell wall assembly protein [Pseudomonas stutzeri]; AA=GCF_000307775.2; RF=na; TAX=1218352; STAX=316; NAME=Pseudomonas stutzeri KOS6; strain=KOS6; AL=Scaffold; RT=Major
Sequence
MEEVIEQLRELNEPVPVPLELPDDDLLVEIEEQLLINLPFGLREFLLQVSDVIYGRLEPV
TATDPQSHTYLPEVAANAWDAGVPRDLIPICQDGRDYYVVDLDGQVTLWDGDDGELTEES
WESVWHWARDVWLES
Download sequence
Identical sequences A0A061JRG2 A0A0T8L027 A4VS52 F2N3C0 F8H7L1 S6JRL8
379731.PST_4181 WP_003291809.1.11668 WP_003291809.1.31855 WP_003291809.1.36575 WP_003291809.1.43901 WP_003291809.1.45895 WP_003291809.1.56336 WP_003291809.1.62806 WP_003291809.1.6831 WP_003291809.1.7470 WP_003291809.1.82288 WP_003291809.1.85630 WP_003291809.1.88125 WP_003291809.1.90639 WP_003291809.1.9384 WP_003291809.1.98540 gi|386022907|ref|YP_005940932.1| gi|339496243|ref|YP_004716536.1| gi|146284492|ref|YP_001174645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]