SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003327979.1.62747 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003327979.1.62747
Domain Number 1 Region: 9-414
Classification Level Classification E-value
Superfamily Serpins 2.09e-99
Family Serpins 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003327979.1.62747
Sequence length 416
Comment MULTISPECIES: proteinase inhibitor [Bacillus subtilis group]; AA=GCF_000830075.1; RF=na; TAX=1452; STAX=1452; NAME=Bacillus atrophaeus; strain=NRS 1221A; AL=Complete Genome; RT=Major
Sequence
MQTKNGWMMFLLLLLALAGCGQPSAEHPASQMSSSKTSPSAQSADGIHKEFIEAEGLFGI
SVFHHLIEQQGTEKNVFISPYSIQQALVMTANGADGKTKEEMKNTLLLSEMKDREINEAA
NTLMNSFRTLFDGELLAAHSVWTGLDINPQFKQTIEQHFDGKACKLGPHPEKAKRKINEW
AAKKTKGHIEDIADNLSPNTIAVLLNTIYFQGDLAQPFDKAMTYVEPFYLQNGTEKKHPM
MKQTALLPYQENELFQAVKLSYKNKDLSFAVFLPQKDKDLSSLTASLTHENLEKWENRWE
EKTVKLSLPRFSFEEKYNLRGILTQLGMKTAFGKADFSNLFQDKSTGAKIDDVNHHTFIK
TDETGTEAAAATSVEIIESASGPELSLTVNRPFLFVIADEKTKSILFLGTVAEPAE
Download sequence
Identical sequences A0A0H3E6R8
gi|311070914|ref|YP_003975837.1| WP_003327979.1.100936 WP_003327979.1.10353 WP_003327979.1.15971 WP_003327979.1.16994 WP_003327979.1.32777 WP_003327979.1.39473 WP_003327979.1.39900 WP_003327979.1.40255 WP_003327979.1.59507 WP_003327979.1.62747 WP_003327979.1.68581 WP_003327979.1.69262 WP_003327979.1.70004 WP_003327979.1.72589 WP_003327979.1.72801 WP_003327979.1.7305 WP_003327979.1.7508 WP_003327979.1.79721 WP_003327979.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]