SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003369234.1.14003 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003369234.1.14003
Domain Number 1 Region: 19-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000051
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003369234.1.14003
Sequence length 151
Comment hypothetical protein [Clostridium botulinum]; AA=GCF_001573695.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=ATCC 9564; AL=Contig; RT=Major
Sequence
MENITLNRLKKAGWTNERNINIDLIEKTFKEKSINMPEKIRVFLQKYGMLEIKFKRKMQA
IAIDEVIEFNPIKAIGDNLDSEYFMEIFDEYDIDDVVYPIGIANRGNLLMLMTENETFYR
YTDGFLCKDGENIEEMLDCVVGECKEPIYFE
Download sequence
Identical sequences A0A0L9YD46 C5UVJ4
WP_003369234.1.10246 WP_003369234.1.14003 WP_003369234.1.14250 WP_003369234.1.49945 WP_003369234.1.65636 WP_003369234.1.73899 WP_003369234.1.92433 WP_003369234.1.92626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]