SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003374359.1.97908 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003374359.1.97908
Domain Number 1 Region: 290-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.75e-47
Family Ribonuclease PH domain 1-like 0.0000164
Further Details:      
 
Domain Number 2 Region: 8-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-40
Family Ribonuclease PH domain 1-like 0.0000291
Further Details:      
 
Domain Number 3 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.18e-25
Family Ribonuclease PH domain 2-like 0.0043
Further Details:      
 
Domain Number 4 Region: 447-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-23
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 606-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-21
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 6 Region: 236-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.09e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 
Domain Number 7 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.38e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003374359.1.97908
Sequence length 704
Comment polyribonucleotide nucleotidyltransferase [Clostridium botulinum]; AA=GCF_000827935.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=NCTC 8266; AL=Complete Genome; RT=Major
Sequence
MNNVLSTNIAGKEMKVEFGKIGMLSNAATFMSYGDTVILTNVNASSEPRVGIDFFPLSVE
YEERLYAVGKIPGGFIKREGRPSEKAILNGRAVDRTLRPLFPKGYRNDVQVVCTVVSVEK
DNLPEILAINAASMALCLSSIPFAMPVAAVQVGLIDNNFIVNPNATEREESTLHLTVCAT
KERVMMIEAGGNEIPEDIMIAAIKFGFDECQNIINFQEEAVKKFGKEKDIPTLFTVDEEV
EKDIKEFASDMIKEAMYITDKDERNAAIDAVNQKVKEEFGEKYEDKFGDIKEVLYNMQKK
VVRHMLLKDKRRPDGRAFDQVRPLGCEVGLLPRTHGTGLFTRGLTQVMTVATLGAVGDIQ
ILDGIDEAQSKRYMHHYNFPGYSVGEVKPLRGPGRREIGHGALAERALEPLIPSEEEFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPLKRPAAGIAMGLITSEDLSEEQVLTDI
QGIEDFFGDMDFKVAGTTEGITSIQVDTKLKGFSFNVVENAIRDARKARMTILEKINECI
SSPREDVSLYAPKTETIQIDPDKIRSVIGAGGKVINKIIQDTGVKIDIKEDGSVFVSSSD
HEGVKEAIKIIEGLTKDVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNK
VEDVVSVGDEILVKVTEIDSQGRINLSRKDVLLDQENKENKEEK
Download sequence
Identical sequences A0A0M1LVY1 B2V4H5 C5UX63
gi|188589111|ref|YP_001920624.1| WP_003374359.1.10246 WP_003374359.1.14003 WP_003374359.1.14250 WP_003374359.1.16164 WP_003374359.1.17341 WP_003374359.1.1917 WP_003374359.1.31784 WP_003374359.1.32697 WP_003374359.1.43682 WP_003374359.1.53901 WP_003374359.1.58365 WP_003374359.1.64077 WP_003374359.1.64452 WP_003374359.1.65636 WP_003374359.1.73899 WP_003374359.1.87966 WP_003374359.1.92433 WP_003374359.1.92626 WP_003374359.1.9385 WP_003374359.1.97908 508767.CLH_1230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]