SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003404192.1.21789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003404192.1.21789
Domain Number 1 Region: 1-112,140-509
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-168
Family Clostridium neurotoxins, catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 498-828
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 6.28e-118
Family Clostridium neurotoxins, "coiled-coil" domain 0.00052
Further Details:      
 
Domain Number 3 Region: 842-1022
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.99e-36
Family Clostridium neurotoxins, the second last domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003404192.1.21789
Sequence length 1197
Comment peptidase M27 [Clostridium botulinum]; AA=GCF_000019305.1; RF=na; TAX=498213; STAX=1491; NAME=Clostridium botulinum B1 str. Okra; strain=Okra; AL=Complete Genome; RT=Major
Sequence
MNINDNLSINSPVDNKNVVVVRARKTDTVFKAFKVAPNIWVAPERYYGESLSIDEEYKVD
GGIYDSNFLSQDSEKDKFLQAIITLLKRINSTNAGEKLLSLISTAIPFPYGYIGGGYYAP
NMITFGSAPKSNKKLNSLISSTIPFPYAGYRETNYLSSEDNKSFYASNIVIFGPGANIVE
NNTVFYKKEDAENGMGTMTEIWFQPFLTYKYDEFYIDPAIELIKCLIKSLYFLYGIKPSD
DLVIPYRLRSELENIEYSQLNIVDLLVSGGIDPKFINTDPYWFTDNYFSNAKKVFEDHRN
IYETQIEGNNAIGNDIKLRLKQKFRININDIWELNLNYFSKEFSIMMPDRFNNALKHFYR
KQYYKIDYPENYSINGFVNGQINVQLSLSDRNQDIINKPEEIINLLNGNNVSLMRSNIYG
DGLKSTVDDFYSNYKIPYNRAYEYHFNNSNDSSLDNVNIGVIDNIPEIIDVNPYKENCDK
FSPVQKITSTREINTNIPWPINYLQAQNTNNEKFSLSSDFVEVVSSKDKSLVYSFLSNVM
FYLDSIKDNSPIDTDKKYYLWLREIFRNYSFDITATQEINTDCGINKVVTWFGKALNILN
TSDSFVEEFQNLGPISLINKKENLSMPIIEIYGIPNDMLGLPLNDLNEKLFNIYLKNILY
FKKVYFNFLDQWWTEYYSQYFDLICMAKQSILAQEKLIKQIIQNKLQDLFKADISMDKLN
LMNLATEKTFIDLSNESQIAINNINDFLNKSAICVFDTNIYPKFISFMEQCINSVNSNVT
AFIQKCTNITEDEKLQLIKLNTFMNIDFEFFDIQSIKDLITSETDLIKEEKESDYNLFLF
TLQEDNNKVIEDISGKNTLVKYSDSISLVYGVNGDALYLKEPDESVSFSNKAFENGLTNS
FSICFWLRNLGEDIITSKLIENKADNCGWEIYFENNGLVFSIVDCNGNEENIYLSDVISK
NWYYISISIDRLRNQLLIFINDKLIANQSIEQILNIYSSNTISLVNENNPIYIEGLSILN
RSITSEEVVNNYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSI
KDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDT
AKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALKGI
Download sequence
Identical sequences B1INP6 P71117 Q33CP4
gi|169834701|ref|YP_001693308.1| gi|169834701|ref|YP_001693308.1|NC_010379 498213.CLD_A0069 WP_003404192.1.21789 WP_003404192.1.53136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]