SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003512569.1.20586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003512569.1.20586
Domain Number 1 Region: 51-150
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000383
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003512569.1.20586
Sequence length 278
Comment hypothetical protein [Ruminiclostridium thermocellum]; AA=GCF_000255615.2; RF=na; TAX=1138384; STAX=1515; NAME=Ruminiclostridium thermocellum AD2; strain=AD2; AL=Complete Genome; RT=Major
Sequence
MLEIISCSRRTDIPAFYYDWLQECLKNKYAVVKNPYNKSTYMVDLSCEKVHSICLWSKSF
ANVLKDPKYLSLYNLYFQFTITGYSKFLEPNVIDTNEAVRQMEQLAQKYSPRQINWRFDP
IIFSAEGEKEPTPDNFERARLKVFENLCKDISSFGVNRCTISFLCLYKKVEQRMKKCNFT
YFPPSQQKQIEFVSRLVEIADKYQVTIYTCSSPVIESVPGVKKGHCIDGAYLEELFGKRA
SRAKDSGQRKECGCTRSKDIGGYDNQSCRHGCVYCYAR
Download sequence
Identical sequences A3DC88
gi|385779231|ref|YP_005688396.1| 203119.Cthe_0329 WP_003512569.1.16390 WP_003512569.1.19387 WP_003512569.1.20586 WP_003512569.1.31213 WP_003512569.1.55520 WP_003512569.1.60145 WP_003512569.1.6636 WP_003512569.1.6965 gi|125972850|ref|YP_001036760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]