SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003512705.1.60145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003512705.1.60145
Domain Number 1 Region: 36-412
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.93e-84
Family beta-glycanases 0.00000155
Further Details:      
 
Domain Number 2 Region: 462-524
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000177
Family Type I dockerin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003512705.1.60145
Sequence length 526
Comment endoglucanase [Ruminiclostridium thermocellum]; AA=GCF_000173015.1; RF=na; TAX=492476; STAX=1515; NAME=Ruminiclostridium thermocellum JW20; strain=JW20; AL=Contig; RT=Major
Sequence
MRKVKALLLGLIVLAVALLPTVSFKSPTVAADPNNDDWLHVEGNKIVDMYGNQVWLTGCN
WFGFNTGTNVFDGVWSCNMREALKGMADRGINFLRIPISTELLYQWSQGIYPKANVNDFV
NPELKGKNSLELFDFAVQCCKEFGIKIMVDIHSPATDAMGHMYPLWYDGQFTTEIWISTL
EWLTERYKNDDTILALDLKNEPHGTPGSELMAKWDGSTDLNNWKHAAETCAKRILAINPN
ILIVVEGVEVYPKPGYDYTAVDEWGKESKYFYNWWGGNLRGVRDYPIDLGKHQKQLVYSP
HDYGPLVHKQPWFYEGFNKETLYNDCWRDNWAYIHEENIAPLIVGEWGGFMDRGDNEKWM
KALRDYMIENKISHTFWCYNANSGDTGGLVYYDFITWDEEKYALLKPALWQTEDGKFIGL
DHQIPLGSNGITVTEYYGGYIPEPSPTATVPDVPTPSHSFEIEKGDVNGDGNVNSTDVVW
LRRFLLKLVEDFPVPSGKQAADMNDDGNINSTDMIALKRKVLKIPI
Download sequence
Identical sequences A3DCG4 Q1JR84
203119.Cthe_0405 WP_003512705.1.16390 WP_003512705.1.19387 WP_003512705.1.20586 WP_003512705.1.31213 WP_003512705.1.55520 WP_003512705.1.60145 WP_003512705.1.6636 WP_003512705.1.6965 gi|125972926|ref|YP_001036836.1| gi|385779158|ref|YP_005688323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]