SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003513365.1.60145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003513365.1.60145
Domain Number 1 Region: 36-74,106-523
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-130
Family Cellulases catalytic domain 0.0000000381
Further Details:      
 
Domain Number 2 Region: 721-871
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.24e-48
Family Cellulose-binding domain family III 0.00011
Further Details:      
 
Domain Number 3 Region: 543-698
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.94e-40
Family Cellulose-binding domain family III 0.00012
Further Details:      
 
Domain Number 4 Region: 879-946
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.34e-18
Family Type I dockerin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  WP_003513365.1.60145
Domain Number - Region: 68-113
Classification Level Classification E-value
Superfamily EF-hand 0.00271
Family Calmodulin-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003513365.1.60145
Sequence length 947
Comment glycosyl hydrolase [Ruminiclostridium thermocellum]; AA=GCF_000173015.1; RF=na; TAX=492476; STAX=1515; NAME=Ruminiclostridium thermocellum JW20; strain=JW20; AL=Contig; RT=Major
Sequence
MKTGFSTVKKVQVIFLIICMITSIIAVPSYVSAEPEYNFAKALQLSLYFYDANKCGEGIT
GGRLEWRGDCHLEDKEVPLIPMTEDYFGTNMSQEYIDKYRHIFDPDGDGTVDLSGGMHDA
GDHVKFGLPGTYAASTLGWGFYEFREAYEKVGVDDHAKEILRWFNDFYLKATFLDEDGNV
IAYCYQVGEGNIDHNFWNPPELQSSKVLDLFARPAYFATPETPASDQCAGAAASLAINYL
NFKDEDPEYAQRCLDTAIALYEFAKKYRGLGESGGFYGSSYDHDELAWAAVWLNIATGDM
QYIDDIVATDSEGNYIGYMQRIIKDTTNTWQNIWVHCWDTVWGGVFAKLAPITNTERDWY
IFRWNLEYWSGIPHENPNDTTFLAKSPGGFSVVNAYGSARYNTAAQLCALVYRKYTGRSD
FADWAKSQMEYIMGNNPMNRCYIVGYSENSAKHPHHRAAHGSKTFSMLDPEEHRHTLWGA
LVGGPDLDDFHVDETTDYVYNEVAVDYNAAFVGACAGLYYYYGEALGHKPVPNFPPKEEA
VEEYYVEGKIEQENKERTQVTIKIFNDTCHPPRFETGLMARYFFNISELLDAGQSIDDVK
IEVYYDENKASYDGPAEVRGPIKYDDAGTYYVEVDWSGRIIYGKREIQLALISSLDSNYK
SNWNPENDYSREGLGKEFVRTEKIPLYLNGVKVFGNEPPQIEPSPTPSDGPGSTPPPSQK
PSLEVLYKYGDTTAATKDIRGSIKIKNTGTKPVNLSDVKVRYWFTKDGASSQEFVCDYAH
LSESMITAKFVDLENPVENADNYLEIGFDSNAGILGPGSDTGEIQFRIVKGDYESYDQSN
DYSCMATAKDFTANPNITAYVNSVLVYGNPPVDEEEEIEIVYGDLNGDGRVNSTDLLLMK
KRIIREIDKFNVPDENADLNLDGKINSSDYTILKRYVLKSIEKLPVK
Download sequence
Identical sequences gi|385780287|ref|YP_005689452.1| WP_003513365.1.19387 WP_003513365.1.20586 WP_003513365.1.55520 WP_003513365.1.60145 WP_003513365.1.6636 WP_003513365.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]