SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003514601.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003514601.1.6636
Domain Number 1 Region: 275-460,522-568
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.1e-42
Family Type II chitinase 0.0053
Further Details:      
 
Domain Number 2 Region: 66-149
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 1.83e-20
Family Copper amine oxidase, domain N 0.0024
Further Details:      
 
Weak hits

Sequence:  WP_003514601.1.6636
Domain Number - Region: 27-78
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0471
Family Copper amine oxidase, domain N 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003514601.1.6636
Sequence length 583
Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MKKKILGCFVIVVLLAVLAAIPLAGYYLYFKPNDEVVPAFAEGELVLVVEGEKVLSKNSP
KILEGEVLLPFDIVKEYFDPHIFWDEALGKVTITTKDRVIRMKTDKLDAIVNNQPITLNI
PVTVENDVVYIPIEFLAEFYGIEVSYVEKSNVVIIDYKNSIKQIAEPIDPEAVVRKGRSI
REPIIRKFDLSSGDTAENTLRIFEEYDKWYKVRTWDGAIGYIEKRFVVVKKLMVEKISDD
KTPKPAWTPPKGKINLAWDMIYTRREDHSSLGEMKGLDVISPTWFQVKNAKGELINRAYS
KYVDWAHSRGYQVWALLSNDFTDSEMTSKFLNNTDARDNLIREILAYAALYNLDGINIDF
ENMYISDRDVFTQFVREIAPLLREQGLVVSVDVNDIQCYDKKALSEAVDYIMYMSYDQHW
STSPVAGSVAQVSWQEKIVKRVLEQEGVPREKLLLGIPFYTRLWKETVDESGKKKLTSSA
LTMKQAKNLIIENNAKVEWDEESGQFYAEYTKDNTNYRLWLEDANSINLRTSLVHKYRLA
GTCAWSIYFVSEDIWDVLNKNLKEIESYQEWLEQNRNNQYKFP
Download sequence
Identical sequences A3DJG4
WP_003514601.1.19387 WP_003514601.1.20586 WP_003514601.1.31213 WP_003514601.1.55520 WP_003514601.1.60145 WP_003514601.1.6636 WP_003514601.1.6965 gi|125975376|ref|YP_001039286.1| gi|385777811|ref|YP_005686976.1| 203119.Cthe_2895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]