SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003514882.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003514882.1.31213
Domain Number 1 Region: 45-328
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.55e-51
Family beta-glycanases 0.000000304
Further Details:      
 
Domain Number 2 Region: 430-555
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-31
Family Family 6 carbohydrate binding module, CBM6 0.0000373
Further Details:      
 
Domain Number 3 Region: 324-420
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.37e-26
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0021
Further Details:      
 
Domain Number 4 Region: 561-629
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.41e-21
Family Type I dockerin domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003514882.1.31213
Sequence length 630
Comment carbohydrate-binding protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MRKLRKLLLFSTVLFVVFTQLFGFIITVDAAETATINLSAEKQVIRGFGGMNHPVWISDL
TPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVFASPWNPPSNM
VETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWT
PQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNM
PYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIR
RSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSAYKNKKDNSVVAVV
INKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFVG
GGSSEPQIPVERNAFSKIECEEYNATNSSTVQVVGTGTGSGLGYIENGNYFAYKNINFGN
GANSFKIRAATTGTPKIEIRLGSPTGTLAGTLQVAATGGFNAYEEQSCSINKITGVQDVY
LVFGGAVNVDWFTFESKQEPTFKYGDLNGDGNVNSTDSTLMSRYLLGIITTLPAGEKAAD
LNGDGKVNSTDYNILKRYLLKYIDKFPVES
Download sequence
Identical sequences A3DJS9
WP_003514882.1.19387 WP_003514882.1.20586 WP_003514882.1.31213 WP_003514882.1.55520 WP_003514882.1.60145 WP_003514882.1.6636 WP_003514882.1.6965 203119.Cthe_3012 gi|385777931|ref|YP_005687096.1| gi|125975491|ref|YP_001039401.1| CmR10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]