SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003515869.1.60145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003515869.1.60145
Domain Number 1 Region: 231-640
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.11e-102
Family Bacterial glucoamylase C-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003515869.1.60145
Sequence length 644
Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_000173015.1; RF=na; TAX=492476; STAX=1515; NAME=Ruminiclostridium thermocellum JW20; strain=JW20; AL=Contig; RT=Major
Sequence
MANTYFNDAIIGNSGMLVCLTRNGELTRLFWPNIDYPQHFEKMATGIFYTGQKNSTSWFY
EDNWHHTQYYVEDTNILKTICEDGGRGLRVEQTDFVLKDRDVMVRRYVIENIGPNEVDLG
FVQYSSTVSTTPELRSTLFDFNVDALIHYRHNYYISISSDSEVVQFQLGNNAFDCARYTE
LYGYDSIGMMKDGAMSFNIGKIEPGGKKTFNLFICASHTLKGVKELVRWCRKMNVDEEYE
KTRKYWLDFLKNARLIVTGDKNIDNLYKRSILVFKLMSDERTGGLLASAEIDEGFTRCGR
YAYCWGRDAAFITGALDTAGLTEAVDKFYQWAVMTQDDDGSWQQRYHMDGNLAPSWGLQI
DETGTLIWGMLKHYEVTKNIDFLKSMWESIKKGVEFLTRFIDSDTGLPAPSYDLWEERVG
EHTYSSAAVYAGIKAGAEAARILGASEELIEKWEKAASDMKASIEKNFWRDEAGRFIRSV
RTKLNPWGSEHSPYTTVIKVNEKGYFRDVTLEDWTIDVSLLGVSIPFGVFDVHDERVKKT
VEAIERALTSHPVGGIKRYENDNYIGGNPWVLATLWVALYYIEIKEYEKAKDYLRWATKS
CTALGLLPEQVSKDNGEPCWVIPLTWSHAMYVLVLAGLKEAGVL
Download sequence
Identical sequences A3DGC9
WP_003515869.1.16390 WP_003515869.1.19387 WP_003515869.1.20586 WP_003515869.1.31213 WP_003515869.1.55520 WP_003515869.1.60145 WP_003515869.1.6636 WP_003515869.1.6965 203119.Cthe_1787 gi|385779760|ref|YP_005688925.1| gi|125974291|ref|YP_001038201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]