SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003516196.1.6965 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003516196.1.6965
Domain Number - Region: 79-175
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00843
Family Family 1 of glycosyl hydrolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003516196.1.6965
Sequence length 215
Comment hypothetical protein [Ruminiclostridium thermocellum]; AA=GCF_000175715.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=DSM 2360; AL=Contig; RT=Major
Sequence
MIQIDDAGSGSFVGGTCIGVYRPETNEYFFEIIPVELYNKENFKKKLYLDAVVDIVEEAF
KALNVHKSETVEICRGYMFEKLRHWLDANGYCWYRTHISGRIQEIVEQNFMLYTMRLGVP
EAYLKYTKYPFHFHKLLRWVFADYNNRISLCKTGWQSWAKYEGIQREVHDDVMKYSHIFC
LKCGKHIRKGSRIKILRFVSNKEHFVYLHSKCHEC
Download sequence
Identical sequences A3DDB0
gi|125973222|ref|YP_001037132.1| WP_003516196.1.16390 WP_003516196.1.19387 WP_003516196.1.20586 WP_003516196.1.31213 WP_003516196.1.55520 WP_003516196.1.60145 WP_003516196.1.6636 WP_003516196.1.6965 gi|385778868|ref|YP_005688033.1| 203119.Cthe_0704 Cth-667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]