SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003516277.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003516277.1.31213
Domain Number 1 Region: 714-940
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.32e-41
Family Tail specific protease, catalytic domain 0.00099
Further Details:      
 
Domain Number 2 Region: 535-690
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-30
Family delta-Endotoxin, C-terminal domain 0.0028
Further Details:      
 
Domain Number 3 Region: 356-445
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 2.75e-25
Family Copper amine oxidase, domain N 0.0025
Further Details:      
 
Domain Number 4 Region: 134-324
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000000000196
Family Tricorn protease N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  WP_003516277.1.31213
Domain Number - Region: 43-147
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.017
Family Tricorn protease N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003516277.1.31213
Sequence length 950
Comment copper amine oxidase [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MKKIKQMKVALFLFSFLSVIVFMSVSSLALPDVPKKSSNTSGNMANNGRVLKYDGWVYYS
FDESGLYRMKEDGSQKKKICDGMYDNLTAYDGYIYGYCRYTKTNNPEETGLFRLKPDGTE
RVKISDKSMLFVTIYDGWIYYTSFDDNFKPYKMKLDATDDQKLSDYSASYINVDNQWVYF
QNDANGGRIYKVKHDGSQITEVSDHGNMYTYLNIDGEWIYFSGHYFLYKMKVDGTELTPL
FEELINNVNSKDSWIYFSVFEEGIYRIKTDGTQLQKLRDVEDFVSGISLTDEWLYYEVYD
VKDSSTRVYRMRLDGSSHQKFKITEDHVPDEVENVKIRIDGKFGEYSNVPLNLYGRILLP
FREILKNLGVPDDDKHIIWDGKNRTVTVKKDNITILLTIGKNTALVNGKEYVLDVAPIIY
NDRTYIPTRFIAESLNKKVLWDGEKQIVSICEPAEFEKVKDILAKTNDAMVNSVERYSVD
QKNSMKYNNDYLDYEIQMTAKLEIDSKKRLCNIVGERKILETGNITNFNSEETSNIYCWC
ENEKIYLKDENYDLWYESELTEDEWENFKRRVLSNYSYINADDLICSGFTVDETDEHYIL
KGEHIFDELISGALYELDIVNEIISGTNTELLINKKTYYLEKINTTVTGKEKSSYGGNFS
IAVSLENTNFNSEARVTAPEGFDPDKLINKKAVELVNFISQAYLYFNEIDNFEEKSKEFI
TKKDFNFDDVKQYIEAIKADDDVFTVCVDENSLEYGYKEEQIETKDLGKDAVYIKIKSFT
EDVGDKFIEEADKIENSEDKTLVIDLRDNGGGFIISANDILDYLLPRCLMNYYISRSGDM
LPVYSNDDYKEFKQILILVNENTASSAELLALGLKKHLKNTTVIGRTTLGKGVGQLVYRD
DDKKFSVYLVSFYWNVKEQNVMKSGITPDIVVNSDSDYLKEVEKLLKSKR
Download sequence
Identical sequences A3DDF0
WP_003516277.1.19387 WP_003516277.1.20586 WP_003516277.1.31213 WP_003516277.1.55520 WP_003516277.1.6636 WP_003516277.1.6965 gi|385778826|ref|YP_005687991.1| 203119.Cthe_0744 gi|125973262|ref|YP_001037172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]