SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003516583.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003516583.1.6636
Domain Number 1 Region: 13-88
Classification Level Classification E-value
Superfamily E set domains 1.59e-17
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003516583.1.6636
Sequence length 400
Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MKYPFYYCCDNLDIKSISVIGDFNNWDGGKNILKRHDDGTWMTEIELSPGKYRYKFLIND
SILFNDPNALIYTYDDKGGTASFIIIDESNKRIINTKPASLNIESYSFLSVDKELSYCEN
GERKCYKDKHSSIMLKIGFSDITGLHTVNAIWYAPNNEIHEIQESVLNDGEKNENRKNEA
LFQININDDTIAGEWKLQIFINGSLALEDSFTVELKQPEVLDKTALDDAAMLSADLEVPD
FLIEEDMQNEFEAPEFEVESNLQTNAEKEEISEEDLLGLFDDIKEIDMPEKDTSGNQKTP
APDETEMPADGNIMNLFDEIRISELKDEKAQDTENNTESTSKEAEESDSAIDELLELREF
IDSSQNSEKDSIESSGGKSGEEANEEDISDIFIDIKNRTD
Download sequence
Identical sequences A3DD45
gi|125973157|ref|YP_001037067.1| Cth-1196 WP_003516583.1.16390 WP_003516583.1.19387 WP_003516583.1.20586 WP_003516583.1.31213 WP_003516583.1.55520 WP_003516583.1.60145 WP_003516583.1.6636 WP_003516583.1.6965 203119.Cthe_0639 gi|385778935|ref|YP_005688100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]