SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003517595.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003517595.1.6636
Domain Number 1 Region: 29-479
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.44e-167
Family Cellulases catalytic domain 0.00000000000714
Further Details:      
 
Domain Number 2 Region: 484-638
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.52e-45
Family Cellulose-binding domain family III 0.00000944
Further Details:      
 
Domain Number 3 Region: 666-738
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.18e-16
Family Type I dockerin domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003517595.1.6636
Sequence length 739
Comment endoglucanase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MKKILAFLLTVALVAVVAIPQAVVSFAADFNYGEALQKAIMFYEFQRSGKLPENKRNNWR
GDSALNDGADNGLDLTGGWYDAGDHVKFNLPMAYAVTMLAWSVYESRDAYVQSGQLPYIL
DNIKWATDYFIKCHPSPNVYYYQVGDGALDHSWWGPAEVMQMPRPSFKVDLTNPGSTVVA
ETAAAMAASSIVFKPTDPEYAATLLRHAKELFTFADTTRSDAGYRAAEGYYSSHSGFYDE
LTWASIWLYLATGDQSYLDKAESYEPHWERERGTTLISYSWAHCWDNKLYGSLLLLAKIT
GKSYYKQCIENHLDYWTVGFNGSRVQYTPKGLAYLDRWGSLRYATTQAFLASVYADWSGC
DPAKAAVYKEFAKKQVDYALGSTGRSFVVGFGKNPPRNPHHRTAHSSWSALMTEPAECRH
ILVGALVGGPDGSDSYVDRLDDYQCNEVANDYNAGFVGALAKMYEKYGGEPIPNFVAFET
PGEEFYVEAAVNAAGPGFVNIKASIINKSGWPARGSDKLSAKYFVDISEAVAKGITLDQI
TVQSTTNGGAKVSQLLPWDPDNHIYYVNIDFTGINIFPGGINEYKRDVYFTITAPYGEGN
WDNTNDFSFQGLEQGFTSKKTEYIPLYDGNVRVWGKVPDGGSEPDPTPTITVGPTPSVTP
TSVPGIMLGDVNFDGRINSTDYSRLKRYVIKSLEFTDPEEHQKFIAAADVDGNGRINSTD
LYVLNRYILKLIEKFPAEQ
Download sequence
Identical sequences P26224
203119.Cthe_0543 gi|125973062|ref|YP_001036972.1| gi|385779037|ref|YP_005688202.1| WP_003517595.1.16390 WP_003517595.1.19387 WP_003517595.1.20586 WP_003517595.1.31213 WP_003517595.1.55520 WP_003517595.1.60145 WP_003517595.1.6636 WP_003517595.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]