SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003517920.1.60145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003517920.1.60145
Domain Number 1 Region: 118-261
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.73e-29
Family Cellulose-binding domain family III 0.0004
Further Details:      
 
Domain Number 2 Region: 43-83
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00000575
Family Copper amine oxidase, domain N 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003517920.1.60145
Sequence length 263
Comment cellulosome anchoring protein cohesin region [Ruminiclostridium thermocellum]; AA=GCF_000173015.1; RF=na; TAX=492476; STAX=1515; NAME=Ruminiclostridium thermocellum JW20; strain=JW20; AL=Contig; RT=Major
Sequence
MNGVHMMKKWLCILVIVVLASTCLIAYAAEANQWTALRATFKVFVKGEEFKSQDPIVAIN
GRTYLPLKAIGDVLGVDVVWNEGLRRVEVAMSENQNGDKPDVAPVVAIHEAETADYILDV
LVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFD
YNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGATKKYSLITFGES
NFCDFDLKPILAVLKEGKVEIEK
Download sequence
Identical sequences WP_003517920.1.16390 WP_003517920.1.19387 WP_003517920.1.20586 WP_003517920.1.55520 WP_003517920.1.60145 WP_003517920.1.6636 WP_003517920.1.6965 gi|385779111|ref|YP_005688276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]