SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003519462.1.16390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003519462.1.16390
Domain Number 1 Region: 6-425
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.1e-122
Family Family 1 of glycosyl hydrolase 0.000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003519462.1.16390
Sequence length 442
Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_000493655.1; RF=na; TAX=1349417; STAX=1515; NAME=Ruminiclostridium thermocellum BC1; AL=Contig; RT=Major
Sequence
MVTFKLNDEFMFGTATASTQIEGGDTGNTWYKWCQEGRIKDSSSCITACDHWNRVEEDTE
LLKNLGVQTHRMSLEWSRIEPSRGKFSDDAMKHYRDEIKLLVENNIKPLVTLHHFSEPIW
FHEMGGWKKTGNADIFIEYVKYVVENLGDLVSDWVTFNEPNVYVDFGYVIGIFPPGERSL
SEGLKVTAELINTHVKLYRLIHRIRRERKFAGRTMVGTAMHLRIFDGISSTGKMIAKVVD
YLFNEMFMEGMTTGHMMFPLSKKGSSHKKGRYADFLGINYYTRNIVEFVFDPSLYFHELV
CDKDLTKSDLGWDIYPEGIYKVCKRYYKKYKLPIYITENGISDKNDTKRPSFIASHLAYI
AKAIKEGIPIERYYYWTLMDNFEWLEGESTDFGLYDCNFRTQERIPRKSVRLYEQICRRK
ELTAEMIEDFKKYSGITIETIR
Download sequence
Identical sequences A3DFD0
gi|125973942|ref|YP_001037852.1| gi|385778175|ref|YP_005687340.1| Cth-1324 203119.Cthe_1428 WP_003519462.1.16390 WP_003519462.1.19387 WP_003519462.1.20586 WP_003519462.1.31213 WP_003519462.1.55520 WP_003519462.1.60145 WP_003519462.1.6636 WP_003519462.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]